KEGG   Wolbachia wBm (Brugia malayi): Wbm0746Help
Entry
Wbm0746           CDS       T00234                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
wbm  Wolbachia wBm (Brugia malayi)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:wbm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Wbm0746 (recR)
DNA repair and recombination proteins [BR:wbm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Wbm0746 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
978928..979533
Genome map
AA seq 201 aa AA seqDB search
MNINIKNLVHAFSKLPSLGPSSSRRLVIHLLQNKEKVMLPLASSIKELADLIIECKVCGN
LDTQSPCSICTNPKRDTKLMCVVEELGDLWAFEKGSIYSGMYHVLGGRLSAINGIGPEKL
NLDNIPKRVTEFKIEEVIIAINPTLEGQVTVQYIIESLKNLDVKVSRLACGIPMGGEIDY
LDEGTLKAALTSRQEYESNIK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaacattaacataaagaatttagttcatgctttttccaaattgccaagtctagggcca
tcatcatcaagaaggttagttatacacttactccaaaacaaggagaaagtcatgctacct
cttgcatcttcgattaaagagctggcagatcttataatagagtgtaaggtttgcggaaat
ctagatactcaatcaccttgttctatttgtaccaacccaaagcgtgacactaagctaatg
tgcgtagtagaagaattaggcgacttatgggcatttgaaaaaggaagtatatattcaggt
atgtaccatgttttgggcggtagattatcagcaataaatggcataggtccagaaaaactc
aaccttgataatattcctaaaagagtcacagagtttaaaattgaagaggtcattatcgca
attaatccaacattggagggccaagttaccgtacagtatataattgaatcgctaaaaaat
ttagatgtgaaagtatcacgccttgcttgtggtataccaatgggtggcgaaattgattac
ctagatgaaggaacgttaaaagcagcacttacttcaagacaagaatatgagtcgaatata
aaatag

DBGET integrated database retrieval system