KEGG   Wolbachia wBm: Wbm0746Help
Entry
Wbm0746           CDS       T00234                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
wbm  Wolbachia wBm
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:wbm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
978928..979533
Genome map
AA seq 201 aa AA seqDB search
MNINIKNLVHAFSKLPSLGPSSSRRLVIHLLQNKEKVMLPLASSIKELADLIIECKVCGN
LDTQSPCSICTNPKRDTKLMCVVEELGDLWAFEKGSIYSGMYHVLGGRLSAINGIGPEKL
NLDNIPKRVTEFKIEEVIIAINPTLEGQVTVQYIIESLKNLDVKVSRLACGIPMGGEIDY
LDEGTLKAALTSRQEYESNIK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaacattaacataaagaatttagttcatgctttttccaaattgccaagtctagggcca
tcatcatcaagaaggttagttatacacttactccaaaacaaggagaaagtcatgctacct
cttgcatcttcgattaaagagctggcagatcttataatagagtgtaaggtttgcggaaat
ctagatactcaatcaccttgttctatttgtaccaacccaaagcgtgacactaagctaatg
tgcgtagtagaagaattaggcgacttatgggcatttgaaaaaggaagtatatattcaggt
atgtaccatgttttgggcggtagattatcagcaataaatggcataggtccagaaaaactc
aaccttgataatattcctaaaagagtcacagagtttaaaattgaagaggtcattatcgca
attaatccaacattggagggccaagttaccgtacagtatataattgaatcgctaaaaaat
ttagatgtgaaagtatcacgccttgcttgtggtataccaatgggtggcgaaattgattac
ctagatgaaggaacgttaaaagcagcacttacttcaagacaagaatatgagtcgaatata
aaatag

DBGET integrated database retrieval system