KEGG   Wolbachia wBm (Brugia malayi): Wbm0746Help
Entry
Wbm0746           CDS       T00234                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
wbm  Wolbachia wBm (Brugia malayi)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:wbm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Wbm0746 (recR)
DNA repair and recombination proteins [BR:wbm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Wbm0746 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
978928..979533
Genome map
AA seq 201 aa AA seqDB search
MNINIKNLVHAFSKLPSLGPSSSRRLVIHLLQNKEKVMLPLASSIKELADLIIECKVCGN
LDTQSPCSICTNPKRDTKLMCVVEELGDLWAFEKGSIYSGMYHVLGGRLSAINGIGPEKL
NLDNIPKRVTEFKIEEVIIAINPTLEGQVTVQYIIESLKNLDVKVSRLACGIPMGGEIDY
LDEGTLKAALTSRQEYESNIK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaacattaacataaagaatttagttcatgctttttccaaattgccaagtctagggcca
tcatcatcaagaaggttagttatacacttactccaaaacaaggagaaagtcatgctacct
cttgcatcttcgattaaagagctggcagatcttataatagagtgtaaggtttgcggaaat
ctagatactcaatcaccttgttctatttgtaccaacccaaagcgtgacactaagctaatg
tgcgtagtagaagaattaggcgacttatgggcatttgaaaaaggaagtatatattcaggt
atgtaccatgttttgggcggtagattatcagcaataaatggcataggtccagaaaaactc
aaccttgataatattcctaaaagagtcacagagtttaaaattgaagaggtcattatcgca
attaatccaacattggagggccaagttaccgtacagtatataattgaatcgctaaaaaat
ttagatgtgaaagtatcacgccttgcttgtggtataccaatgggtggcgaaattgattac
ctagatgaaggaacgttaaaagcagcacttacttcaagacaagaatatgagtcgaatata
aaatag

DBGET integrated database retrieval system