KEGG   Wigglesworthia glossinidia brevipalpis: WGLp022Help
Entry
WGLp022           CDS       T00101                                 

Gene name
folA
Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
wbr  Wigglesworthia glossinidia brevipalpis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:wbr00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:wbr00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(26330..26818)
Genome map
AA seq 162 aa AA seqDB search
MDISLIWAQSKNKVIGHDQYIPWNLPEDISWFKKNTINKPVIMGRKTFESIKKPLENRIN
IVLSKNLYRNVMSNLKIAKNPKQALFFAKNYNEVMIIGGKQIYKIFLPKATKLYLTVINA
EINGNIFFPRYNRKKWILSFEKYFNSDTKNKYSMYFRIFNKI
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggatataagtttaatttgggctcaatctaaaaataaagtaataggacatgatcaatat
attccatggaatttaccggaagatatatcatggtttaaaaaaaatactataaataaacca
gttattatgggaagaaaaacttttgaatctataaaaaaaccattagagaatcgcattaat
atagtattaagcaaaaacttatatagaaatgtaatgtcaaatttaaaaatagctaaaaat
ccaaaacaagcattattttttgctaaaaattacaacgaagtaatgattattggaggaaaa
caaatttataaaatatttttgcctaaagcaacaaaactttacttgactgttattaatgca
gaaattaatggaaatatattttttccaagatataacagaaaaaaatggattctatcattt
gagaaatattttaatagtgatacaaaaaataaatatagtatgtattttagaatttttaat
aaaatttaa

DBGET integrated database retrieval system