KEGG   Wigglesworthia glossinidia brevipalpis: WGLp132Help
Entry
WGLp132           CDS       T00101                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
wbr  Wigglesworthia glossinidia brevipalpis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:wbr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
153868..154842
Genome map
AA seq 324 aa AA seqDB search
MKYLNKFIRLRRLRSKKSVRNLFQETEVTLKDLILPIFVEEDIDFMKPISSMPGVFRIPE
KLLAYELEKYAKSGINSIITFGISHNLDENGSDTWNNNGLISRILRICKNTVPEIIIISD
MCFCEYTIHGHCGIINNKKVDNDQTLLNLERQSIIAASSGADFVAPSSSMDGQVKAIRSA
LDKSGLCDTGIMSYSTKFHSELYNPFRDATYSNLKGDRKTYQVNPMNRKEAIRESLIDVK
EGSDVLIIKPAINFLDIIRDIKNKTYLPLIGYQVSGEYSMIKLSSKAGIFNERNMIMESI
GSIKRAGASAIITYFAMDIANNIL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatttaaataaatttataagattaagaagattaagaagcaaaaaaagtgttaga
aacttgtttcaagaaactgaagttacattaaaagatcttatattacctatttttgtagaa
gaagatattgattttatgaaaccaatttcttctatgccaggagtatttagaattccagaa
aaattattagcttatgagcttgaaaaatatgctaaatctggaattaattccataataaca
tttggaatatctcataatttagatgaaaatggaagtgacacatggaacaataatggtcta
atatctagaatattgcgtatatgcaaaaatactgttccagaaataattattatatcagat
atgtgtttttgtgaatatacaattcatgggcattgtggaataattaataataaaaaagtt
gataatgatcaaactttattaaatctagaaagacaatcaataatagctgctagctcagga
gcagattttgttgctccatcttcttctatggatggtcaggttaaagcaattagatcggct
ctagataaatcaggtttatgtgatactggaataatgtcttattctactaaatttcattca
gaactatataatccatttagagatgctacatattctaatttgaaaggggatagaaaaact
tatcaagttaatcctatgaacagaaaagaagcaataagagaatctttaatcgacgtaaaa
gaaggatctgacgttttaataataaaaccagctattaattttttagatataatcagagat
ataaaaaataaaacatatttacctttaataggatatcaagtaagcggtgaatattcaatg
attaaattatcttctaaagcaggtatttttaatgaaagaaatatgatcatggaatccatt
ggatcaataaaaagggctggagctagtgcaataataacatattttgcaatggatatagct
aacaatattctatga

DBGET integrated database retrieval system