KEGG   Wigglesworthia glossinidia brevipalpis (Glossina brevipalpis): WGLp218Help
Entry
WGLp218           CDS       T00101                                 

Gene name
gpmA
Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
wbr  Wigglesworthia glossinidia brevipalpis (Glossina brevipalpis)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:wbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WGLp218 (gpmA)
   01230 Biosynthesis of amino acids
    WGLp218 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WGLp218 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    WGLp218 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    WGLp218 (gpmA)
Enzymes [BR:wbr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     WGLp218 (gpmA)
Exosome [BR:wbr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   WGLp218 (gpmA)
  Exosomal proteins of melanoma cells
   WGLp218 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
254973..255677
Genome map
AA seq 234 aa AA seqDB search
MSIIKLVLMRHGSSIWNDQDRFTGWTDIDLSEKGKNEVKYAGKMLKSFGYSFNFAYTSLL
KRAIHSLWVILKEINQSWIPVEKSWRLNERHYGALQGFSKYEIEKKYGKNQLNEWRRGFS
ISPPKINEKDNYFILNDKRYLNLKTKKLLPFSESLKSTIDRIMPYWDGNIFPRLQNKEKI
IIVAHGNSIRAIIKILCNLNEKEIIKINIPTGIPLIYEFDYNMVFKKKYFLFDR
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtctataattaaattagttctaatgcgacatggttctagtatttggaacgatcaagat
cgttttactggatggacagatattgatttatctgaaaaaggaaagaatgaagtcaaatat
gcagggaaaatgttgaaatcttttggttattcatttaattttgcatatacttctttgtta
aaaagagcaatacatagtttatgggttattttaaaagaaataaatcaatcttggattcca
gtagaaaaatcttggagattaaatgaaagacattacggtgcattgcaaggatttagtaaa
tatgaaattgaaaagaaatatggaaagaatcaattaaatgaatggagaagaggattttct
atttcacctccaaagataaatgaaaaggataattattttattttaaatgataaaagatat
ttaaatttaaaaacaaaaaaattacttcctttttcagaaagtctaaaatctacaattgat
agaataatgccatattgggatggaaatatatttccaagattgcaaaataaagaaaaaata
ataatcgtagctcatggaaattcaattagagctataataaaaattttatgtaatcttaat
gaaaaagaaattataaaaattaatatacctactggtatacctttaatatatgaatttgat
tataatatggtttttaaaaaaaaatattttctttttgatagataa

DBGET integrated database retrieval system