KEGG   Wigglesworthia glossinidia brevipalpis (Glossina brevipalpis): WGLp241Help
Entry
WGLp241           CDS       T00101                                 

Gene name
hemD
Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
wbr  Wigglesworthia glossinidia brevipalpis (Glossina brevipalpis)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:wbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    WGLp241 (hemD)
Enzymes [BR:wbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     WGLp241 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
284141..284878
Genome map
AA seq 245 aa AA seqDB search
MTILITRPYPHGQHLINMIRKNGKEAWYLPLIYFTSGIGLLSLTNFFKKLQEKDIICSLS
PRATKYANYQILLEKCNWPKKINYYAIGKTSAFYLSKYSKCKVIYPKLTENSENLLDLIS
KEDVKKKILILKGNNGRKFLENKLKLYGAYIINVECYKRNFIKYNKYDYLKKIINLKINT
LVVTSSEILHQLHNNIPLNYINFFLINFKLVVVSKRISDIADNLGWKNIIVSKSSKNKDI
IQSLL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgacaatattaattacaaggccttatccacatggacaacatcttataaacatgattaga
aaaaatggcaaagaagcttggtatttgcctttaatttattttacatctggaataggttta
ttatcccttactaacttttttaaaaaattacaggaaaaagatattatatgttcactttct
ccaagggcaactaaatacgctaattatcaaattttattagaaaaatgcaattggcctaaa
aaaataaattactatgctataggaaaaactagtgcattttatttaagtaaatacagtaaa
tgcaaagttatttatcctaaattaacagaaaatagtgaaaatttattagatttaatatca
aaagaggatgttaaaaaaaaaatattaattttgaaaggaaataatggacgtaaattttta
gaaaataaattaaagttatatggagcttatataataaatgttgaatgttacaaaagaaat
ttcattaaatacaataaatatgattatttgaaaaaaattataaatttaaaaattaatact
ttagttgtaactagctcagaaattttacatcaattgcataataatattcctttaaattat
ataaatttttttttaattaattttaagttagtcgtagttagcaaaagaataagtgatata
gcagataatttaggatggaaaaatataatagtttccaaatcttctaaaaacaaagatata
attcaatctttattataa

DBGET integrated database retrieval system