KEGG   Wigglesworthia glossinidia brevipalpis (Glossina brevipalpis): WGLp267Help
Entry
WGLp267           CDS       T00101                                 

Gene name
recD
Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
wbr  Wigglesworthia glossinidia brevipalpis (Glossina brevipalpis)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:wbr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    WGLp267 (recD)
Enzymes [BR:wbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     WGLp267 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
315053..316057
Genome map
AA seq 334 aa AA seqDB search
MMSIAYLSAEYRLGKSFLPLKNLSFKNLNYKFNKSISKLILEKLGNIKNIEEIEKNLIDS
NIVSNGEKKLPFVLFKKNFYFYKVWIQEKAFKKFLKNLTYSPITLDNFNILKIINKNIYS
NINNYKQIILTILLYKVVWVFTEHDSTKNYLIKNILSIFFKLKKENFHIMICSSNKKSIY
FLSKILKEIKNKCKNNNFIIEVLLLKDILNNNSNIIYYYKYPINFDIIIIYDSFMINLSI
MYDIISLYNKRLFRIIFIENYSCLNNLEKNSILIRMFNYGKFSKSFSFIKRINKIEENIK
ISNKLNFTNESKISDCVCITEENKKKYIQHPNID
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgatgtctatagcttatttaagcgcagaatatagacttggaaagtctttcttacctttg
aaaaatctttcttttaaaaatcttaattataaatttaataaatcaatatcaaaattaata
ttggaaaaattaggaaatataaaaaatattgaagaaatagaaaaaaatttaatcgattca
aatatagtaagtaatggagaaaaaaaattaccatttgttttatttaaaaaaaatttttat
ttttataaagtttggattcaagagaaagcttttaaaaaatttttaaaaaatttaacatat
agtccaattacattagataactttaatatcttaaaaattataaataaaaatatatactca
aacataaataattataaacaaattatattaacaatactactttataaagtagtatgggta
tttacagaacatgattctacaaaaaattatctaataaaaaatattttatcaatttttttt
aaattaaaaaaagaaaactttcatattatgatatgcagttcaaataaaaaatcaatttat
tttctgtcaaaaatattgaaagaaataaaaaataagtgtaaaaataataattttataata
gaagtattattgcttaaagatatattaaataataatagtaatataatttattattataaa
tatcctataaattttgatataattattatatatgattctttcatgataaatttatctatt
atgtatgatattatctctctttataataaaagattgtttagaatcatattcatcgaaaat
tattcttgtttaaataatttagaaaaaaattccattctaataagaatgtttaattatgga
aaattttctaaaagtttttcttttataaaaagaataaacaaaatagaagaaaatataaag
atatcaaataaattaaattttacaaatgaatctaaaatatcagattgtgtttgtataaca
gaagaaaataaaaaaaaatacatacaacatcctaatatagattag

DBGET integrated database retrieval system