KEGG   Wigglesworthia glossinidia brevipalpis (Glossina brevipalpis): WGLp274Help
Entry
WGLp274           CDS       T00101                                 

Gene name
tpiA
Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
wbr  Wigglesworthia glossinidia brevipalpis (Glossina brevipalpis)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:wbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WGLp274 (tpiA)
   01230 Biosynthesis of amino acids
    WGLp274 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WGLp274 (tpiA)
   00051 Fructose and mannose metabolism
    WGLp274 (tpiA)
   00562 Inositol phosphate metabolism
    WGLp274 (tpiA)
Enzymes [BR:wbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     WGLp274 (tpiA)
Exosome [BR:wbr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   WGLp274 (tpiA)
  Exosomal proteins of bladder cancer cells
   WGLp274 (tpiA)
  Exosomal proteins of melanoma cells
   WGLp274 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(324239..325009)
Genome map
AA seq 256 aa AA seqDB search
MKLKPLILSNWKLNGNCLLVKKILLKLNEKLKNKNNLKVVIAPPVIYLSEFKKYVLKKNI
FLAAQNVDVNLTGSFTGEISPIMLYEFGVKYVIIGHSERRLYHNESIEDVTKKFLILKKF
NLIPVLCIGETKKNKDDKCIENEIVKQIDFILKKIGIEGFINTVIAYEPTWAIGKKDSAS
PKYIQKIHKFIRNYLSKYDNDISKKIILQYGGSVNSKNVKKIISQKDVNGVLLGRSSTNI
EEFLYILDIIEKTKKS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgaaaccgttgatattatcaaattggaaattaaatggtaattgtttgttggta
aaaaagattttgcttaaattaaatgaaaaattgaaaaacaaaaataatttaaaagttgtt
attgctcctccagtaatatatttaagtgaatttaaaaaatatgttttaaaaaaaaatatt
tttttagctgcacaaaacgtggatgttaatttaacagggtcttttactggagaaatttct
ccaataatgttatatgaatttggcgtaaagtatgtaattataggtcattctgaaagaaga
ttataccataatgaaagcattgaagatgtaactaaaaaattcttaatacttaaaaaattt
aatttaattccagtattatgcattggagaaacaaaaaaaaacaaagatgataaatgtata
gaaaatgaaatagttaaacaaattgattttatattgaaaaaaattgggatagaaggtttt
ataaatacagttattgcatatgaacctacatgggctataggaaagaaagactctgctagt
cctaaatatattcaaaaaattcataaattcattagaaactatttatcaaaatatgataat
gatatttctaaaaaaattattttacaatatggaggatctgtaaattcaaaaaatgtaaaa
aaaattatttctcaaaaagacgttaatggtgttttattagggagatcttctacaaatata
gaagaatttttatatattttagatattatagaaaaaacaaaaaaatcataa

DBGET integrated database retrieval system