KEGG   Wigglesworthia glossinidia brevipalpis: WGLp274Help
Entry
WGLp274           CDS       T00101                                 

Gene name
tpiA
Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
wbr  Wigglesworthia glossinidia brevipalpis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:wbr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:wbr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:wbr00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:wbr00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:wbr00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(324239..325009)
Genome map
AA seq 256 aa AA seqDB search
MKLKPLILSNWKLNGNCLLVKKILLKLNEKLKNKNNLKVVIAPPVIYLSEFKKYVLKKNI
FLAAQNVDVNLTGSFTGEISPIMLYEFGVKYVIIGHSERRLYHNESIEDVTKKFLILKKF
NLIPVLCIGETKKNKDDKCIENEIVKQIDFILKKIGIEGFINTVIAYEPTWAIGKKDSAS
PKYIQKIHKFIRNYLSKYDNDISKKIILQYGGSVNSKNVKKIISQKDVNGVLLGRSSTNI
EEFLYILDIIEKTKKS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgaaaccgttgatattatcaaattggaaattaaatggtaattgtttgttggta
aaaaagattttgcttaaattaaatgaaaaattgaaaaacaaaaataatttaaaagttgtt
attgctcctccagtaatatatttaagtgaatttaaaaaatatgttttaaaaaaaaatatt
tttttagctgcacaaaacgtggatgttaatttaacagggtcttttactggagaaatttct
ccaataatgttatatgaatttggcgtaaagtatgtaattataggtcattctgaaagaaga
ttataccataatgaaagcattgaagatgtaactaaaaaattcttaatacttaaaaaattt
aatttaattccagtattatgcattggagaaacaaaaaaaaacaaagatgataaatgtata
gaaaatgaaatagttaaacaaattgattttatattgaaaaaaattgggatagaaggtttt
ataaatacagttattgcatatgaacctacatgggctataggaaagaaagactctgctagt
cctaaatatattcaaaaaattcataaattcattagaaactatttatcaaaatatgataat
gatatttctaaaaaaattattttacaatatggaggatctgtaaattcaaaaaatgtaaaa
aaaattatttctcaaaaagacgttaatggtgttttattagggagatcttctacaaatata
gaagaatttttatatattttagatattatagaaaaaacaaaaaaatcataa

DBGET integrated database retrieval system