KEGG   Wigglesworthia glossinidia brevipalpis (Glossina brevipalpis): WGLp317Help
Entry
WGLp317           CDS       T00101                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
wbr  Wigglesworthia glossinidia brevipalpis (Glossina brevipalpis)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    WGLp317 (folE)
Enzymes [BR:wbr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     WGLp317 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
373905..374555
Genome map
AA seq 216 aa AA seqDB search
MEVLTKEALLVKNALLNKGIETPFKKIYEKNKPDIHKISKYIKKIMDLLNLDLNNDSLSK
TPNRIAYMYIEEIFSGLNYNNFPKITLIKNTSKINDLITVNNIVLNSTCEHHFLIFEGKA
IVSYIPDKILIGLSKINRIVDFFSKRPQIQERLTNQILVAIQILLDTKNVAVAIKAKHLC
VKARGIKDSHSKTLTLSLGGVFKSKQNIKKEFLKDF
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcttaacaaaagaagctttactagtaaaaaatgctttattaaacaaaggcata
gaaactccatttaaaaaaatttatgaaaaaaataaaccagatatacataaaatatctaaa
tacattaaaaaaataatggatcttttaaatttagatttaaacaatgatagcttgtcaaaa
actcctaatagaattgcttatatgtatatagaagaaatattttcaggtctaaattataat
aattttccaaaaataacattaataaaaaatacctctaaaattaatgatttaattacagta
aataatattgttttaaacagcacatgtgaacatcattttttaatttttgaaggaaaagca
attgtatcatatattccagacaaaattttaattggactatctaaaataaatcgcattgtt
gattttttttctaaaagacctcaaattcaagaaagattaactaatcaaattttagttgct
attcaaattttgcttgatactaaaaatgtagcagtagcaattaaagctaagcatctttgc
gtgaaagctcggggaataaaagattctcacagtaaaactttaactctatctttgggtgga
gtttttaaatccaaacaaaacataaaaaaagaatttttaaaagatttttaa

DBGET integrated database retrieval system