KEGG   Wigglesworthia glossinidia brevipalpis (Glossina brevipalpis): WGLp331Help
Entry
WGLp331           CDS       T00101                                 

Gene name
dapA
Definition
(RefSeq) dihydrodipicolinate synthase (EC:4.2.1.52)
  KO
K01714  
4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
wbr  Wigglesworthia glossinidia brevipalpis (Glossina brevipalpis)
Pathway
Monobactam biosynthesis
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:wbr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    WGLp331 (dapA)
  Amino acid metabolism
   00300 Lysine biosynthesis
    WGLp331 (dapA)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    WGLp331 (dapA)
Enzymes [BR:wbr01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     WGLp331 (dapA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(390660..391556)
Genome map
AA seq 298 aa AA seqDB search
MFTGSIVALITPMKKSGKIDFDSIKGLIEYHIVNNTSAILAIGTTGENFSLTFEEQCNIV
KYIFETCDKKIPVIAGIISSNIENIKKQINFYNKINISGILISTPYYSCPTQNGIFNYFK
EISKNTDIPQIIYNNPKRTGCDILPETVSKLSYIKNIIGIKDSSKDLSRVKKIKFFSKKN
FCLLCGDDINILDFMQLGGCGVISTAANIIAYESSSLCRLINNRHYYKAEKLYYNILDLY
KILLIAPNPTPIKWACNFLGLIKTKYIRLPMIGLNKKEIFMFKKILNKIKLKSKINCI
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtttacaggaagtatagtagcgttaataactccaatgaaaaaatctggtaaaatagat
tttgatagcataaagggattaatcgaatatcacattgtcaataatacttctgctatatta
gcaataggaacaactggagaaaatttttctttaacttttgaagagcaatgcaatattgtc
aaatatatttttgaaacatgcgacaaaaaaatacctgttatagcaggtataatatcatct
aatattgaaaatattaagaaacaaattaatttttataataaaataaatatatcgggaatt
ttgatatctactccttattatagttgtccgacacaaaatggtatatttaattactttaaa
gaaatttctaaaaatacagacataccgcagattatctataataatcctaaaaggactgga
tgcgatattttacctgaaactgtttcaaaattatcatatataaaaaatataattggaata
aaagattccagcaaagacttaagtagagtaaaaaaaataaagtttttttctaaaaaaaat
ttttgtttattatgtggagatgatattaacatattagattttatgcaattaggaggatgt
ggtgtaatttctaccgctgcaaatattatcgcatatgaatcttcaagtttatgcagatta
attaataatagacattattataaagcagaaaaattatattataatattttagacttatat
aaaattttattaatagctcctaatccaacacccataaagtgggcttgtaattttttaggt
ttgataaaaacaaaatatataagattgccaatgattggtttaaataaaaaagaaattttt
atgtttaaaaaaatattaaataaaattaaattaaaaagcaaaattaattgtatttaa

DBGET integrated database retrieval system