KEGG   Wigglesworthia glossinidia brevipalpis: WGLp331Help
Entry
WGLp331           CDS       T00101                                 

Gene name
dapA
Definition
dihydrodipicolinate synthase (EC:4.2.1.52)
Orthology
K01714  
4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
wbr  Wigglesworthia glossinidia brevipalpis
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:wbr01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:wbr00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(390660..391556)
Genome map
AA seq 298 aa AA seqDB search
MFTGSIVALITPMKKSGKIDFDSIKGLIEYHIVNNTSAILAIGTTGENFSLTFEEQCNIV
KYIFETCDKKIPVIAGIISSNIENIKKQINFYNKINISGILISTPYYSCPTQNGIFNYFK
EISKNTDIPQIIYNNPKRTGCDILPETVSKLSYIKNIIGIKDSSKDLSRVKKIKFFSKKN
FCLLCGDDINILDFMQLGGCGVISTAANIIAYESSSLCRLINNRHYYKAEKLYYNILDLY
KILLIAPNPTPIKWACNFLGLIKTKYIRLPMIGLNKKEIFMFKKILNKIKLKSKINCI
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtttacaggaagtatagtagcgttaataactccaatgaaaaaatctggtaaaatagat
tttgatagcataaagggattaatcgaatatcacattgtcaataatacttctgctatatta
gcaataggaacaactggagaaaatttttctttaacttttgaagagcaatgcaatattgtc
aaatatatttttgaaacatgcgacaaaaaaatacctgttatagcaggtataatatcatct
aatattgaaaatattaagaaacaaattaatttttataataaaataaatatatcgggaatt
ttgatatctactccttattatagttgtccgacacaaaatggtatatttaattactttaaa
gaaatttctaaaaatacagacataccgcagattatctataataatcctaaaaggactgga
tgcgatattttacctgaaactgtttcaaaattatcatatataaaaaatataattggaata
aaagattccagcaaagacttaagtagagtaaaaaaaataaagtttttttctaaaaaaaat
ttttgtttattatgtggagatgatattaacatattagattttatgcaattaggaggatgt
ggtgtaatttctaccgctgcaaatattatcgcatatgaatcttcaagtttatgcagatta
attaataatagacattattataaagcagaaaaattatattataatattttagacttatat
aaaattttattaatagctcctaatccaacacccataaagtgggcttgtaattttttaggt
ttgataaaaacaaaatatataagattgccaatgattggtttaaataaaaaagaaattttt
atgtttaaaaaaatattaaataaaattaaattaaaaagcaaaattaattgtatttaa

DBGET integrated database retrieval system