KEGG   Wigglesworthia glossinidia brevipalpis (Glossina brevipalpis): WGLp331Help
Entry
WGLp331           CDS       T00101                                 

Gene name
dapA
Definition
dihydrodipicolinate synthase (EC:4.2.1.52)
Orthology
K01714  
4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
wbr  Wigglesworthia glossinidia brevipalpis (Glossina brevipalpis)
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:wbr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    WGLp331 (dapA)
  Amino acid metabolism
   00300 Lysine biosynthesis
    WGLp331 (dapA)
Enzymes [BR:wbr01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     WGLp331 (dapA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(390660..391556)
Genome map
AA seq 298 aa AA seqDB search
MFTGSIVALITPMKKSGKIDFDSIKGLIEYHIVNNTSAILAIGTTGENFSLTFEEQCNIV
KYIFETCDKKIPVIAGIISSNIENIKKQINFYNKINISGILISTPYYSCPTQNGIFNYFK
EISKNTDIPQIIYNNPKRTGCDILPETVSKLSYIKNIIGIKDSSKDLSRVKKIKFFSKKN
FCLLCGDDINILDFMQLGGCGVISTAANIIAYESSSLCRLINNRHYYKAEKLYYNILDLY
KILLIAPNPTPIKWACNFLGLIKTKYIRLPMIGLNKKEIFMFKKILNKIKLKSKINCI
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtttacaggaagtatagtagcgttaataactccaatgaaaaaatctggtaaaatagat
tttgatagcataaagggattaatcgaatatcacattgtcaataatacttctgctatatta
gcaataggaacaactggagaaaatttttctttaacttttgaagagcaatgcaatattgtc
aaatatatttttgaaacatgcgacaaaaaaatacctgttatagcaggtataatatcatct
aatattgaaaatattaagaaacaaattaatttttataataaaataaatatatcgggaatt
ttgatatctactccttattatagttgtccgacacaaaatggtatatttaattactttaaa
gaaatttctaaaaatacagacataccgcagattatctataataatcctaaaaggactgga
tgcgatattttacctgaaactgtttcaaaattatcatatataaaaaatataattggaata
aaagattccagcaaagacttaagtagagtaaaaaaaataaagtttttttctaaaaaaaat
ttttgtttattatgtggagatgatattaacatattagattttatgcaattaggaggatgt
ggtgtaatttctaccgctgcaaatattatcgcatatgaatcttcaagtttatgcagatta
attaataatagacattattataaagcagaaaaattatattataatattttagacttatat
aaaattttattaatagctcctaatccaacacccataaagtgggcttgtaattttttaggt
ttgataaaaacaaaatatataagattgccaatgattggtttaaataaaaaagaaattttt
atgtttaaaaaaatattaaataaaattaaattaaaaagcaaaattaattgtatttaa

DBGET integrated database retrieval system