KEGG   Wigglesworthia glossinidia brevipalpis (Glossina brevipalpis): WGLp348Help
Entry
WGLp348           CDS       T00101                                 

Gene name
ychB
Definition
hypothetical protein
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
wbr  Wigglesworthia glossinidia brevipalpis (Glossina brevipalpis)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:wbr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WGLp348 (ychB)
Enzymes [BR:wbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     WGLp348 (ychB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
406187..407101
Genome map
AA seq 304 aa AA seqDB search
MHFNNKNKSLDCLNTKIWPSPAKINLFLSVTGIRKDGYHFIQTLFQFLNYGDYLIFNTTS
DKKIKLINKIHGIRNENNLIIRAAKSLKDFMWKNKNHDTPGVKIFIKKYIPIGGGLGGGS
SNAATTLIALNEHWKCKLSLNTLADLGLQIGIDIPVFIYGKSAFAEGIGEKLSLFQPKEK
FYLIVIPPIKISTKLIFNKFILNKKSYLKSCNQYLKKPLKNDFEPMIRKNFIIIDNLINY
LSKFSNFRLTGTGSCIFSEFDSECKAKEILYKLPNKIKGFVSKGTNISYLKEILKIRSNF
NVLS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcattttaataataaaaataaatcgttggattgtttaaatacaaaaatatggccatct
ccagcaaaaataaatttatttttatcagtcactggaattagaaaagacggatatcatttt
atacaaactttatttcaatttttgaattatggagattatttaatttttaatactacttcg
gataaaaaaataaaattaataaataaaatacatggaattagaaatgaaaataatctaatt
attagagcagctaaatctttaaaagattttatgtggaaaaataaaaatcatgatactcct
ggagtaaaaattttcattaaaaaatatatacctataggaggaggattaggaggaggatct
tctaatgcagcaacaactttaatagctttaaacgaacattggaaatgtaaattaagttta
aatactttagcggatttaggattacaaatcggaatagatattccagtttttatatatgga
aaatcagcatttgcagaaggtataggagaaaaattatcattgtttcaacctaaagaaaaa
ttttatttaatagtaataccacctataaaaatttctactaaattaatatttaataaattt
attttaaataaaaaaagttatttaaaatcttgtaatcaatatttgaaaaaaccattaaaa
aatgattttgaaccaatgataagaaaaaattttattattattgataatttaattaattat
ttgtctaaattttcaaattttagattaactggaacaggtagctgcattttttctgaattt
gattcagaatgtaaagctaaagaaatattgtataaattaccaaataaaatcaaaggattt
gttagcaaaggaaccaatatatcttatctaaaagaaattttaaaaataagatctaatttt
aatgttttatcttaa

DBGET integrated database retrieval system