KEGG   Wigglesworthia glossinidia brevipalpis (Glossina brevipalpis): WGLp369Help
Entry
WGLp369           CDS       T00101                                 

Gene name
galU
Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
wbr  Wigglesworthia glossinidia brevipalpis (Glossina brevipalpis)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:wbr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    WGLp369 (galU)
   00052 Galactose metabolism
    WGLp369 (galU)
   00500 Starch and sucrose metabolism
    WGLp369 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    WGLp369 (galU)
Enzymes [BR:wbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     WGLp369 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(428659..429498)
Genome map
AA seq 279 aa AA seqDB search
MKIKKVVIPIAGLGKRMLPITKVIPKELLPLIDKPLIQYAIHECINSGLKNIIFVTNYKK
YLIKNYIENIFLKKKCNFQKKLNIDYIYQKSVNGLGNAILSALPKIGYKSFAVILPDVII
NSYSCNNLKINNLLSMLNRFEKTGRSQVLVKLSYNTKDYGIVNCKKSKLNPNDISKIINI
IEKPYIKNSIPSLSVVGRYVFSKNIWGMLEKIKPGIENEFQLTDAIKMLIKNEIVEAYCI
KGSSYDCGNKLGYMKAFVKYGLYNKYFGKVFKKWLKKIL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaaaaaagttgttattccaatagcaggtttagggaaaagaatgcttccaatt
acaaaagtaattccaaaagaattattgccattaattgataaaccattaattcaatatgct
atacatgaatgcattaattctggtctaaaaaatataatttttgttactaattataaaaaa
tatttaattaaaaattatattgaaaatatttttttaaaaaaaaaatgtaattttcaaaaa
aaattaaatattgattatatatatcaaaaatctgtaaatggattaggaaacgctatttta
tctgctttacctaaaataggatataaatccttcgccgttattttgcctgatgttatcatc
aattcatattcatgtaataatttaaaaataaataatcttttatctatgttaaatagattt
gaaaaaactggaagaagccaagttttagtaaaattatcttataatacaaaagattatgga
atagtaaattgcaaaaaaagcaaacttaatccaaatgatatttcaaaaatcattaatatt
atagaaaaaccttatataaaaaatagtattcctagtttatctgttgttggaagatatgtt
ttttctaaaaacatttggggtatgctagaaaaaataaaaccaggaatagaaaatgaattt
caattaacagatgctataaaaatgttaataaaaaatgaaattgtggaagcatattgcata
aaaggatctagctatgattgtggtaataaattaggatatatgaaggcttttgtaaaatat
ggtttatataataaatattttggaaaagtttttaaaaaatggttaaagaaaatattataa

DBGET integrated database retrieval system