KEGG   Wigglesworthia glossinidia brevipalpis (Glossina brevipalpis): WGLp418Help
Entry
WGLp418           CDS       T00101                                 

Gene name
sucB
Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
wbr  Wigglesworthia glossinidia brevipalpis (Glossina brevipalpis)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:wbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WGLp418 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WGLp418 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    WGLp418 (sucB)
Enzymes [BR:wbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     WGLp418 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(480134..481375)
Genome map
AA seq 413 aa AA seqDB search
MNIIDILVPDLPESVTDAVVSNWRKKPGEYVKSGEILVDLETDKVVLEVPSPNSGKIIEI
FQKNSSIVVSKQKIASLNINNYDQKKEENKIKEINFSQKEHNYECSENNKEKETKHADDI
NLSPSIRRSILKHNLNKNDINKNFDIKNNIENELNENNYLTKEKEKNENNIKDSSAYEKS
SPRENRIKMTRLRKCIAERLLYSKNTTASLTTFNEVNMKSIHDLRKSYGDIFEKLHGIRL
GYMSFFVLAVVKGLKKFPEIHAYIDGDDIVYNNYFDINIAISTERGLVTPILRNVDKMNM
SEIEKRIKNLAFLGKNGKLKVEDLQCGSFTITNGGIFGSMMSTPIINPPQSAILGIHAIK
DRVISINKKISINPMTYLALSYDHRLIDGKESASFLSNIKDMLENPIRMLLDI
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaatattatagatatattagttcctgatcttccagaatcagtaacagatgcagtggta
tctaattggagaaaaaaaccaggagaatatgtaaaatctggagaaattctggttgattta
gaaacagataaagttgtgctagaggttccatctccaaattctggaaaaattatagaaatt
tttcaaaaaaattcgtctattgtagtatcaaaacaaaaaatagcaagtttaaatattaat
aattatgatcaaaaaaaagaagaaaataaaataaaagaaataaatttttctcaaaaagaa
cataattatgaatgttcagaaaacaataaagagaaagaaacaaaacatgctgatgatatt
aatttatctccatctattcgcagatcaatattaaaacataatttaaataaaaatgatatt
aataaaaattttgatatcaaaaataatattgaaaatgaattaaatgaaaataattattta
acaaaagaaaaagaaaaaaatgaaaacaatataaaagatagttcagcttatgaaaaaagc
tctccaagagaaaatagaataaaaatgactagattaagaaaatgtatagcagaacgttta
ttatattctaaaaacacaactgcttcattaactactttcaacgaagttaatatgaaatct
atacatgatttaagaaaatcatatggagatatttttgaaaaacttcatgggataagatta
ggatatatgtctttttttgttttagcagtagtaaaaggattaaaaaaatttccagaaatt
catgcatacatagatggagacgacatagtatataataattattttgatattaacatagca
atatctactgaacgaggattagttactccaatattaagaaatgtagataaaatgaatatg
tcagaaatagaaaaaagaattaaaaaccttgcttttctaggaaaaaatggaaaattaaaa
gttgaagaccttcaatgtggtagttttaccataactaatggtggaatttttggatctatg
atgtccactccaattataaatcctcctcaaagtgcaatattaggaatacatgctattaag
gatagagtaatttctataaataaaaaaatttctattaatcctatgacttatttagcatta
tcttatgaccatagattaattgacggaaaagaatctgctagttttttatcaaatataaaa
gatatgttagaaaatccaattagaatgttattggatatttaa

DBGET integrated database retrieval system