KEGG   Wigglesworthia glossinidia brevipalpis: WGLp422Help
Entry
WGLp422           CDS       T00101                                 

Gene name
sdhD
Definition
hypothetical protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
wbr  Wigglesworthia glossinidia brevipalpis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:wbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WGLp422 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WGLp422 (sdhD)
   00650 Butanoate metabolism
    WGLp422 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    WGLp422 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(486721..487062)
Genome map
AA seq 113 aa AA seqDB search
MVNKESAFGILGIYEWIIIRISGILIFLYVICVSSFIIYETPIKYELWREFFNKSLIKIF
TILTFMSIAIHSWIGLWQIITDYIKSESLRLKLEIVIFLILFAYIIYGIKIII
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggtaaataaagaatctgcttttggaattcttggtatatatgaatggattattataaga
atttctggaatattaatctttttatatgtaatatgcgtttcatcgtttataatttatgaa
acgcctataaaatacgagttgtggcgtgaattttttaataaatcattaataaaaatattt
acaatattaacttttatgtctatagccatacattcttggattggattatggcaaataata
acagattatataaaatccgaatcattaaggctaaaattagaaatagtaatatttttaata
ttatttgcttatattatttatggtattaaaatcataatatag

DBGET integrated database retrieval system