KEGG   Waddlia chondrophila: wcw_0034Help
Entry
wcw_0034          CDS       T01255                                 

Gene name
recD1
Definition
exodeoxyribonuclease V alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
wch  Waddlia chondrophila
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:wch00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    wcw_0034 (recD1)
Enzymes [BR:wch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     wcw_0034 (recD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36859..38589
Genome map
AA seq 576 aa AA seqDB search
MASNSFPHRFSTLESAVKLKALSVVDLEFAKMLLESTSEADELLAALICHLTKSAREGHL
CIKKTSLGLSPSPEEIWLRDCEEDIPSELMQLLKQIPGAFDRIPNTICTSVDSFSKTYPE
QPICKHGRSLYLQKYWVFESHFLTHLLPLVIESPEFLAENCLLEDFLKKSPLNALQKKAV
CQVFRQRFCVISGGPGTGKTHTAGAIVSLYSKMFKERLPKIALTAPTGKAASKLRSSLGS
SDGFCVESYTLHALLGLSPESPYVYPPVKKLPYDLIIVDECSMIDVKLMASLLPSIKEGA
RLVFLGDPDQLPSVEAGSLFSDMIRFLDPSVIVRLEECLRVELKELVNFGKAVNEGRVVS
YPKCVERIIPESQMVWEQELTLIQEILRFFPIHFTLEHTQEVFSAFRVLSPLRNGIFGVD
QLNSKLLQFAYQKAGDGEEYAVPIMITRNHAKRGLFNGETGVLVREKGSTPYALGKNDYA
IFGDRSIPALLLPAFEYAFCMSVHKSQGSEFEHVFLVMPQGSEWFGREMVYTAVTRAKKK
LTLWGEETVIAEALGKCCRRFSGLEERISPFLMSRP
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaaattcattcccccatcgtttttctactcttgaatcggctgtgaaattgaaa
gcgttgtctgtcgtggatttggaatttgcgaaaatgctgcttgaatcgacttcagaggca
gatgagcttttagctgcgttgatttgccatttaacaaaatctgcgcgcgaaggacatctt
tgcataaagaaaacctctcttggattatccccttcgcctgaagaaatttggctaagagat
tgcgaggaggatattccttctgaactcatgcagctccttaagcagattccaggtgcattt
gacagaattcccaatacgatttgcacatctgtcgattctttttcgaaaacctatccagag
cagccgatttgcaaacatgggagatctctttatttgcaaaagtattgggtctttgaatcg
cattttcttacacatctattgccgcttgttatcgaatctcctgagtttttggctgagaat
tgcttattggaagattttcttaagaaatctccattgaatgctttgcaaaagaaggcggtc
tgtcaggtgtttagacaacgattttgcgtgatttcaggaggcccaggtactggaaaaacg
catacggcaggtgctattgtttctctgtattcgaaaatgtttaaggaacgtttgcctaaa
atagcgctcacagctcctacaggaaaggcggcatctaagctgcgttcatctttaggcagt
tctgatggtttttgtgtggaatcctatacgctgcatgcgcttttgggcctttctccagaa
tctccttatgtgtatcccccggtcaaaaaacttccttacgatttgatcatcgttgatgag
tgttcgatgatcgatgtaaaattgatggcatcccttttgccttccattaaagagggggca
cgtcttgtttttcttggagatcccgatcagctaccctctgtagaggcaggatcattattt
tccgacatgatccgttttctcgatccatcggttattgtgcggttggaagagtgcctgcgc
gtggaattgaaagagcttgtcaattttgggaaagcggtcaatgagggaagagttgtctct
tatcccaagtgtgtcgaacggataattccggagtcgcaaatggtttgggagcaggaattg
acgcttatccaagaaattttgcgtttttttccgatacatttcacgttggaacatacacaa
gaagttttcagtgcttttagagtgctgtctccattgcgaaacggcatatttggcgtagac
cagcttaacagcaagcttcttcaatttgcttaccaaaaagcaggagatggagaagaatac
gcagttcctatcatgatcacaagaaatcatgcaaaaagagggctgtttaatggggaaacg
ggcgtattggttcgcgaaaaaggtagcactccttatgcgttgggaaaaaatgattacgcg
atttttggagatcgttcgatccctgctttgctgcttccggctttcgagtatgctttttgc
atgtctgtgcataaaagccagggcagcgaatttgaacatgtttttcttgtaatgcctcag
ggaagcgagtggtttggccgagaaatggtttatacagctgtgacgagggcaaagaaaaaa
ctcacgctttggggagaagagactgtcatcgccgaagctcttggtaaatgttgccggcgt
ttttcaggacttgaagagaggatttcacctttcttaatgagtcgtccttga

DBGET integrated database retrieval system