KEGG   Waddlia chondrophila: wcw_0068Help
Entry
wcw_0068          CDS       T01255                                 

Gene name
rmlC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
wch  Waddlia chondrophila
Pathway
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:wch00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    wcw_0068 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    wcw_0068 (rmlC)
Enzymes [BR:wch01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     wcw_0068 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(73861..74388)
Genome map
AA seq 175 aa AA seqDB search
MKMTPAPLEGVFLINLEKREDERGFFARTFCSEEFREKGLETAFVQANDSFSIEQGTLRG
MHYQLPPFAETKLVRCIKGSLYDAVLDLREDSPTFGQSFGTILSADNRTMMYVPRGFAHG
FLTLEPYTEVYYLVSAPYSPKFERGIRWNDPRFNISWPEPPRVISERDNSHPDFL
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgacaccagccccgctagagggcgtttttctcatcaatcttgaaaaaagagag
gatgaaagaggtttttttgcacgcaccttttgctctgaggaattcagagaaaaagggttg
gaaaccgcttttgtccaggcaaacgactctttcagcatagaacagggaactctaagagga
atgcattatcagctgcctccttttgctgaaacgaaacttgtccgatgcatcaagggttct
ttgtacgatgcagtcctcgatctaagagaggactcgcccaccttcggacaatcgtttgga
accatactttccgctgacaaccgcacgatgatgtacgtaccccgtggttttgcccatgga
tttttaaccctggagccttatacggaagtctactatcttgtttctgctccctattctcct
aaattcgaaagaggcattcgatggaacgaccctcggttcaacatctcttggccagagcct
cctcgagtgatttctgaaagagataactcccatcctgattttttatga

  All links  
No link information was found.   
DBGET integrated database retrieval system