KEGG   Waddlia chondrophila: wcw_0068Help
Entry
wcw_0068          CDS       T01255                                 

Gene name
rmlC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
wch  Waddlia chondrophila
Pathway
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:wch00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(73861..74388)
Genome map
AA seq 175 aa AA seqDB search
MKMTPAPLEGVFLINLEKREDERGFFARTFCSEEFREKGLETAFVQANDSFSIEQGTLRG
MHYQLPPFAETKLVRCIKGSLYDAVLDLREDSPTFGQSFGTILSADNRTMMYVPRGFAHG
FLTLEPYTEVYYLVSAPYSPKFERGIRWNDPRFNISWPEPPRVISERDNSHPDFL
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgacaccagccccgctagagggcgtttttctcatcaatcttgaaaaaagagag
gatgaaagaggtttttttgcacgcaccttttgctctgaggaattcagagaaaaagggttg
gaaaccgcttttgtccaggcaaacgactctttcagcatagaacagggaactctaagagga
atgcattatcagctgcctccttttgctgaaacgaaacttgtccgatgcatcaagggttct
ttgtacgatgcagtcctcgatctaagagaggactcgcccaccttcggacaatcgtttgga
accatactttccgctgacaaccgcacgatgatgtacgtaccccgtggttttgcccatgga
tttttaaccctggagccttatacggaagtctactatcttgtttctgctccctattctcct
aaattcgaaagaggcattcgatggaacgaccctcggttcaacatctcttggccagagcct
cctcgagtgatttctgaaagagataactcccatcctgattttttatga

DBGET integrated database retrieval system