KEGG   Waddlia chondrophila: wcw_0241Help
Entry
wcw_0241          CDS       T01255                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
wch  Waddlia chondrophila
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:wch00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
263579..264949
Genome map
AA seq 456 aa AA seqDB search
MILGAGISGLSLGWFLKRRYGSKIQLTILEQSDRPGGLIRTDFVEGSLFEQGPRSLRTRG
NGLETLKLIEKLQLQSQVIAANPKAKKRYLWTGGKLRKLPTGPLSFLTSPLTRTLPWVML
REMFRKKSVLPDESIASFITRRFGSRVSEKLFDPLTTGIFAGDINKLSIRSCFPDFYQWE
KQYGSVCKGMVRRRRCAKRAGTPFLEHYSRVPLFSFKEGMETLPCALAEVLAPHLRCNTA
VVSLRSCADRLEIGLADGNTLTADHVFSTLPAAKLAPLFENRHRELSTLLMSISGSSVAV
VQLAYFRKVLRKEGFGYLVPSSERESILGCVFDSSVFPQQNQIPEETRLTVMIGGMRAPD
LVNQSEKHLKSLAVKSLESHLGIGTEPDTASVKIVRSAIPQYFVGHMEKVERIGTILARI
YPRMTLAGNHFSGVSVNDCIANSKRIVERMAKFFSV
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
gtgattttaggcgccgggatcagcggtttgtctttgggctggtttcttaaaaggcgctat
ggaagcaaaatccagctgacgattctcgaacaatccgatcgtcctggcggcctcatccgc
actgattttgtggaaggaagtttatttgaacagggaccccgaagtttgaggaccagagga
aacggattggaaacattgaagttgatcgagaaacttcagttgcaatcgcaagtgattgct
gccaatcccaaagcgaaaaaacggtatctttggacaggcggcaaattaaggaagcttcca
acaggccctctctcctttttgacctctcctttaactcggactctcccttgggtaatgctg
cgggagatgtttagaaaaaagagcgttttgcctgatgaatccattgcttcatttatcacc
agacggtttggcagccgagtttcagaaaaacttttcgacccgttgacaacaggaattttt
gcgggcgacatcaataaactttccatccgttcttgctttcccgatttctaccaatgggaa
aagcagtacggttcggtatgcaaaggaatggttcggagaaggcggtgcgcaaagagggcg
ggaactccatttttggaacactactcgcgcgttccccttttttccttcaaagagggaatg
gaaacgctcccttgcgctttagcagaagtattggcgcctcacttgcgttgcaatactgct
gtcgtttcactacgttcttgtgccgatcgtttagaaattggattggcagatggaaatacg
ttgacagcagatcatgtgttttccacgctgccggcagctaagcttgctccactttttgag
aatcggcatcgtgaactttctacgcttttaatgagtatttccggctcctctgttgcagtc
gtgcagttggcctacttccgcaaagtgctgcgcaaagagggattcggatatcttgtgccg
tcatcggaacgcgagtcgattttaggctgtgtctttgactcttccgtttttccgcagcaa
aatcagattcctgaggaaacccgtttaacagtgatgattggaggcatgcgcgcccccgat
ctcgttaatcagtcggaaaaacatcttaaatcacttgctgtgaaatctttagaaagtcat
cttggaatcggtacggaaccggacaccgcatcggtaaaaattgtccggtcggcgattcct
caatattttgtcgggcacatggaaaaagtcgagagaattggcacaatacttgcgcgtatt
tatccgcgcatgactttagccggcaatcatttctctggtgtatcggtgaatgattgcatt
gctaacagcaaacgcattgtagagagaatggcaaaatttttctctgtgtag

DBGET integrated database retrieval system