KEGG   Waddlia chondrophila: wcw_0297Help
Entry
wcw_0297          CDS       T01255                                 

Gene name
pgmA
Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
wch  Waddlia chondrophila
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:wch01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:wch01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:wch00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:wch00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:wch00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
334862..335536
Genome map
AA seq 224 aa AA seqDB search
MSRLILMRHGESEWNKLNQFTGWVDVSLSKKGIEEAIEAGKEIKDIPIDVIFMSTLIRSQ
LTAMLAMSQHSEGKVPVVMHKTDEKLKEWGKIYSDEAKEKTIPCFVSWEINERMYGELQG
YNKKKTAEKFGADQVKVWRRSYSTPPPSGESLQMTAERTIPYFENTIVPFLREGQNVLVS
AHGNSLRSIMMDLDALSEEEVVSLEIPTGKPIIYSYENGNFIRK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgactaatattgatgcgccacggtgagtcggaatggaacaagctcaatcaattt
accggttgggttgatgtttccctctctaaaaaagggatcgaggaagctattgaagcggga
aaagagattaaggatattcccatcgatgtgatctttatgtccactttgatccgttcccag
ctgaccgcgatgcttgcgatgagccagcatagcgaagggaaagttcctgttgtcatgcat
aaaacagatgaaaagttgaaagagtggggaaaaatctactctgacgaggcaaaagagaag
acgattccgtgtttcgtcagctgggagatcaatgaacggatgtatggggagctgcaaggc
tacaataaaaaaaagacagcagagaagtttggggcagatcaagtaaaagtctggagaagg
agctacagcactcctcctcctagtggtgaaagcttacagatgactgcggaaagaaccatt
ccttattttgagaacaccattgtcccttttttaagggaaggacagaatgttcttgtttct
gcgcatggaaactctctcagatcgatcatgatggatctggacgccctttctgaagaagag
gttgtgtcattggaaattcccacagggaagccaatcatttattcctacgaaaacggtaat
tttattagaaaatag

DBGET integrated database retrieval system