KEGG   Waddlia chondrophila: wcw_0341Help
Entry
wcw_0341          CDS       T01255                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
wch  Waddlia chondrophila
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:wch00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:wch00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(377581..378498)
Genome map
AA seq 305 aa AA seqDB search
MAYKSRDIIHIADFSRDEILHILDTAEKLKRSPQSDLLRGKILGSCFFEPSTRTRLSFES
AMHRLGGSVIGFDNASNISTRKGETLRDSMKMLDYYADIAVIRHPLEGSAQLAADSIEIP
VINAGDGSNQHPTQTFLDLFTIRETQGRLESLSIALAGDLKHGRTVHSLAEALISFQCRL
YFIAPESLEMPKPLCDHLKENGIKFSFHRSLEEVMPKLDILYMTRIQEERFQDRKQLQTV
NQSIKATLQLLEQSRPNLKVLHPLPRMQEIDPQVDNSPKAYYFQQAGNGLCTRQALLALT
LLGEI
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggcctataagagtcgcgatatcattcacatagcagatttctcaagagatgaaatcctg
cacattcttgatactgcagaaaaacttaaacggtcgccccaatccgacctattaagggga
aaaattctcggaagttgtttttttgaaccttctacacgtacgcggctctcttttgaatct
gcaatgcaccgtttaggaggatctgtcatcggcttcgataatgcttccaatatctcgaca
cgcaagggagaaacccttcgcgattccatgaaaatgctcgattattacgcggacatcgcc
gtgatccgccatcctctggaaggctcggcgcaattagctgccgacagcatcgaaattccc
gtgatcaacgccggagatggttcaaatcaacacccaacgcaaacatttctcgatctcttc
accatacgagagacgcaaggcaggcttgagagtctctccatcgctcttgccggagacctg
aaacacggccgcactgtccattcgctggcggaagcattgatttcctttcaatgccgcctg
tactttatcgcaccggaatctttggaaatgccgaaaccgctctgcgaccacctcaaagaa
aacgggatcaaattttcctttcacagatctcttgaagaagtgatgcctaaactagatatc
ctatatatgacgcggatacaagaagagcgttttcaagaccgcaaacagttacaaacagtg
aatcaatcgatcaaagcaactcttcagctattggagcagagccggcccaacttaaaggtg
ctgcatccccttccaaggatgcaggaaatcgatccacaggttgacaactcaccaaaggca
tattattttcagcaagcaggcaatggactctgtacaaggcaggcactgcttgcattaact
cttttgggagaaatttaa

DBGET integrated database retrieval system