KEGG   Waddlia chondrophila: wcw_0353Help
Entry
wcw_0353          CDS       T01255                                 

Gene name
murE
Definition
N-acetylmuramoylalanylglutamyl DAP ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
wch  Waddlia chondrophila
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:wch00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:wch00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
393047..394516
Genome map
AA seq 489 aa AA seqDB search
MKLKRLIKDLPNAEIKGSKEIEITGICAHSKQVAPGNLFIAKKGRTFDGSQYIAEAVETG
AAAVLNDIFDPSLKVSQIIHPNVAVVEGKLVSAFYHRPGEELLMVGVTGTNGKTTVSYLI
KHLFDSLEMRPGLIGTIEYLIGDHAAPATHTTPDVATNHKLLREMVNQRSQAAVMEVTSH
ALHQGRVSEISFDVGIFTNLSQDHLDYHKTMDAYCEEKRKLFLSLDPEAKKRKNYPKAAV
VNIDDPWFEKIIDGCRVPIITYGIANHADLRAEEIQLGAEGIVYTLVHQGKRYPVSLPLI
GRFNVLNSLATIGCGISLGVPLNKVLDAVKSFPPVPGRLEYVPNKRGLKLFVDFAHTPDA
LKNVLNCLKELTQGKLIVVFGCGGDRDPYKRSQMGRIAEEFSDLAIITSDNPRSENPANI
MDQIVAGFNDPSCFIKIEDRRKAIEEAIHRATPEDVVLIAGRGHEPYQIFAHQTIEFKDR
EVVEDILHS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaagctaaaacgactcatcaaagatcttccaaacgcagaaatcaaaggctcgaaagag
attgaaatcaccggaatttgtgcgcattccaagcaggtagcgcccgggaatctgttcatt
gccaagaaggggagaacgttcgacggttcgcagtacatcgctgaagctgtagagaccgga
gctgccgccgtactcaatgatatcttcgacccatcattgaaagtgagccagattattcat
ccgaatgtagctgttgtggaaggcaagctcgtctcggcgttttatcatcgcccaggagag
gagctgctgatggtcggggtgacaggaacaaacggaaaaacaacagtttcttatcttatc
aagcatctttttgattctttggaaatgcgccctggattgatcggaacgattgaatatctg
attggagaccacgccgctccggcaacccacacgactccggacgttgccaccaatcacaag
ctgctcagggaaatggtcaatcaaagatctcaagctgcagtaatggaagtgacctctcat
gcattgcatcagggaagagtgagtgaaatctcctttgatgtggggattttcaccaactta
tctcaggatcacctcgattatcacaaaacgatggatgcctattgtgaagagaagcggaag
ctttttttgtctcttgatccggaagctaaaaaaaggaaaaattatcccaaagctgctgtt
gttaatatcgacgatccttggtttgaaaaaattattgacggctgccgggtgccgatcatt
acgtatgggattgccaatcatgcagatctgagagcagaggaaatacagctgggtgcggaa
gggattgtgtatacgttggtgcatcaaggaaaacgctatcctgtttctcttccgttgatc
ggccgatttaacgttttaaacagccttgcgacgatcggatgcggaatatctctgggagtt
cctttgaacaaagtgttggacgccgtgaagagctttcctcctgtgccgggccgcttggaa
tatgtgcccaacaagcgcggattgaagcttttcgttgattttgctcatacaccggatgcg
ttaaaaaatgttttaaattgtttaaaagagctgactcaagggaagttgatcgttgtattt
ggctgcggcggggatcgcgatccttataagcgttcgcaaatggggaggattgccgaggaa
ttttctgatttggccatcatcacttccgataatcctcgttcggaaaatcccgcaaacatc
atggatcaaattgttgcgggctttaatgatccttcctgtttcatcaagattgaagacagg
cgaaaggccatcgaggaggcaattcatcgcgcgacaccggaagatgtggtgctgattgcg
ggcagagggcatgaaccttatcaaatatttgcgcatcaaacaatagaatttaaagatcgc
gaagttgtagaggatatattacattcatga

DBGET integrated database retrieval system