KEGG   Waddlia chondrophila: wcw_0424Help
Entry
wcw_0424          CDS       T01255                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
wch  Waddlia chondrophila
Pathway
wch00020  Citrate cycle (TCA cycle)
wch00640  Propanoate metabolism
wch01100  Metabolic pathways
wch01110  Biosynthesis of secondary metabolites
wch01120  Microbial metabolism in diverse environments
wch01130  Biosynthesis of antibiotics
wch01200  Carbon metabolism
Module
wch_M00009  Citrate cycle (TCA cycle, Krebs cycle)
wch_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:wch00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    wcw_0424 (sucC)
   00640 Propanoate metabolism
    wcw_0424 (sucC)
   00660 C5-Branched dibasic acid metabolism
    wcw_0424 (sucC)
Enzymes [BR:wch01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     wcw_0424 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ADI37796
UniProt: D6YUI5
Position
466289..467455
Genome map
AA seq 388 aa AA seqDB search
MNTHEFQAKKILEKYGMPIPPFRVISDLSELESVISDLALDQAVIKVQVHAGGRGKAGGV
KLAKTPEQIREAAKELLGMKIVNNQTGEEGVVAHKILITALTDYRKEYYMGAVIDRQNAR
AVLMVSPDGGVDIEEVAEKTPDRILKLPMSLNGTFRNYQLIELVKFMGWSKETAKQGIAL
AKGLAKAFMDSDASLFEINPLVETEEGDLLVLDAKLSVDDNALYRQKEIASFYDETQIPK
NEAMAHEHNLAYVSLEGEVGCMVNGAGLAMATMDMVYHFGGTPANFLDVGGGASKEKVAE
GFKIILTDPNVKAILVNIFGGIMNCATLASGIVAAVNELKLQVPLVVRMEGTNVDEGRRI
LAGSGLNIDIADSMTAAAEKAVAAAKGV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacacacacgaatttcaagcaaagaagattctggaaaagtacggtatgcctattcca
ccattcagggtgatctccgatctttccgagctggaatcggttatttccgatcttgcactt
gaccaagcggtcataaaagtgcaagtccatgcgggcgggagaggcaaggccggaggggtt
aaattggcgaaaactccggagcagatccgtgaggcagctaaagagcttcttggcatgaaa
attgtcaacaaccagacgggagaagagggggtagttgcacacaagattctgatcactgct
cttacagactatcggaaggaatactacatgggagctgtgatcgatcggcagaatgcgcgt
gcagtgcttatggtgtcgccggatggaggagtggatattgaagaagtggcggagaaaact
ccggatagaattttaaagcttccgatgagcttgaacggaacttttagaaactatcaactg
atcgaattggtaaaatttatgggatggtcgaaagagactgccaagcagggcatcgcattg
gccaaaggtctcgctaaagcgtttatggacagtgatgcttccctttttgagatcaatcct
ctggttgaaacggaagaaggcgatctgctcgttttggatgccaagctttctgtcgatgac
aatgcactctaccgccaaaaagagatcgcttcattttacgatgaaacgcaaatcccgaaa
aatgaggcgatggctcatgaacacaatcttgcttacgtttctcttgaaggggaggtgggc
tgcatggttaacggagcaggacttgcgatggcgactatggatatggtctaccattttgga
gggacgccggcgaattttctcgacgtcggcggcggagcatccaaagaaaaggttgccgag
ggatttaagattattttgaccgatcccaatgttaaagcaattctggtcaacattttcggc
gggatcatgaattgcgcaactcttgcttcagggattgttgctgcggtgaatgagttaaaa
ttgcaggtgcctctagtcgttagaatggaagggacaaatgtagatgaagggcgccgcatt
ttggcgggatcggggttgaatatcgacattgcagatagtatgacagctgctgcggaaaaa
gcggttgctgcggcaaagggggtgtaa

DBGET integrated database retrieval system