KEGG   Waddlia chondrophila: wcw_0718Help
Entry
wcw_0718          CDS       T01255                                 

Gene name
aceB
Definition
(RefSeq) Malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
wch  Waddlia chondrophila
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:wch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    wcw_0718 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    wcw_0718 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    wcw_0718 (aceB)
Enzymes [BR:wch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     wcw_0718 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
791510..793111
Genome map
AA seq 533 aa AA seqDB search
MQNQKVQGIEILGKMSSEYGEILTDEALSFIGVLHRRFNQRRLDLLEQRAERQQRLNRGE
LPMFLKETEALRNDIGWTVAETPDDLQKRWVEITGPTDRKMVINAMNSGADAFMADFEDA
NSPTWDNLVQGQINLRDAIDGSISFENPDGKTYALNETHATLLVRPRGWHLNEKHCRVDE
EEVSGSLFDFGLYFFHNAHRLLRKGSGPYFYLPKLESHLEARLWNDVFLAAQEALEIPRG
TIRATVLIETILAAFEMEEILFELREHSAGLNAGRWDYIFSVIKKFRRLPGFSLPDRNQI
TMTVPFMRAYTELLVKTCHQRGAHAIGGMAAFIPNRKDPEVTEKALRKVKEDKLREVGDG
CDGTWVAHPDLVPVARAVFEENLEDKANQKDRLREDVHVAAEDLLHFSIPNGTITEEGVR
HNINVALQYLASWLSGKGAAAIDNLMEDAATAEISRAQVWQWIHAGLKTVDGKAVTDEWV
SILIEDELAKIRAFYGELYQEKLFTQARALFEELVFSKHFVEFLTLPAYQKLR
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatcaaaaagtgcaggggatcgaaattttaggaaaaatgtcttctgaatatggg
gaaattttaacggatgaggcgctttccttcattggagtactgcacaggaggtttaatcag
aggcgtttggatctattggagcaaagagcggaaaggcagcagaggctaaataggggagag
ctgccgatgtttcttaaggagactgaagcgttgagaaacgatatcggctggacggttgcc
gaaactccggatgatttgcaaaagagatgggtagagatcacagggccgacagatcgaaaa
atggtgattaatgccatgaattccggagccgatgcgtttatggcggattttgaagacgcg
aactctccgacttgggataatcttgtacaggggcaaatcaatttgcgtgatgcgatcgat
ggctctatctcttttgaaaatcccgatgggaaaacgtatgcgcttaatgaaacgcatgcg
accttgctcgtacgcccaagggggtggcatttaaatgaaaagcactgcagggtcgatgaa
gaagaggtttccggttcgttgtttgattttgggctctatttttttcacaacgcccatcgc
cttttgagaaaaggaagcggcccctacttttatcttcccaagctggaaagccatttagaa
gccagattgtggaacgatgtgtttctcgcagctcaagaggctttggaaattcctcgggga
acaatccgtgcaaccgttttgatcgaaacaattttggctgcttttgaaatggaggagatc
ctttttgaactgcgggaacattcggctgggctgaatgctggaagatgggactatattttc
agtgtgatcaaaaaatttcgccgtcttccgggtttttctctgcctgatcgcaatcagatc
acgatgactgttccttttatgcgggcatatacagaacttttggtgaagacgtgtcatcag
aggggtgctcatgcgattggcgggatggctgcgtttattccgaatcgcaaagatccggaa
gtcacagaaaaagctttgcgaaaagttaaagaagataagctgcgcgaagttggggacggc
tgcgacggcacatgggtagcgcatccggaccttgtgccagttgcaagggctgtttttgag
gaaaaccttgaggataaggcaaatcaaaaagatcggttgagggaagatgtccatgttgcc
gcagaggaccttttgcattttagtattccaaatggaacgattacagaagaaggagtcagg
cataatattaatgttgcgctgcagtatttggcttcctggctctctgggaaaggtgcagcg
gccattgacaatttaatggaagacgctgcgactgcggagatttcgcgggcacaggtttgg
cagtggatccatgcaggcttgaaaactgttgatggaaaggctgtcactgatgagtgggtg
tcgatactgatcgaagatgaactagccaaaattcgtgcgttttatggcgagctttaccag
gaaaagctttttacgcaggcacgtgcgctgtttgaagagcttgttttttccaaacatttt
gtggaatttttaacattgccggcttatcaaaaacttaggtag

DBGET integrated database retrieval system