KEGG   Waddlia chondrophila: wcw_0719Help
Entry
wcw_0719          CDS       T01255                                 

Gene name
aceA
Definition
(GenBank) Isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
wch  Waddlia chondrophila
Pathway
wch00630  Glyoxylate and dicarboxylate metabolism
wch01100  Metabolic pathways
wch01110  Biosynthesis of secondary metabolites
wch01120  Microbial metabolism in diverse environments
wch01200  Carbon metabolism
Module
wch_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:wch00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    wcw_0719 (aceA)
Enzymes [BR:wch01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     wcw_0719 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase RRF_GI
Motif
Other DBs
NCBI-ProteinID: ADI38086
UniProt: D6YVC5
Position
793116..794399
Genome map
AA seq 427 aa AA seqDB search
MYTKEDVASLEKEWETSPRWKGVVRQYSAEQVIKLQGSIAIDYPLARIGAEKLWNLLESE
TFVRALGALSGNQAVQMVQAGLKAIYASGWQVAADANDALQTYPDQSLYPVQSMPHLIRR
INNALKRADQIQHMQNKVNGDWFVPIIADAEAGFGGNLNTFELIKAMIEAGSAAIHLEDQ
LSSQKKCGHMGGKVLVSGDAFIEKLMAARLAADVMGIPTLIIARTDAHSAKLIRSDSYSV
DRPFLTGERSVEGFHYIEGGIPYAIARGLDFAPYCDLVWCETSTPDLGEAREFAQGIHEK
YPGKWLAYNCSPSFNWKAKLDDRSIRDFQEKLGEIGYKFQFVTLAGFHTLNASMFDLARQ
YKEEGMAAYSRFQEREFELERQGGFSAIKHQQFVGAGYFDMVTMTLSQGQSSTTALAGST
EEEQFNL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtatacaaaagaagatgttgcgtcgttggaaaaggagtgggagacctctccccgctgg
aagggggttgttcggcaatattctgcagagcaagtgatcaagttgcaaggatcgattgcc
attgattatccattagccagaataggagcggaaaaactctggaatttactggagagtgaa
acgtttgtgcgggctttgggtgctttatcgggaaatcaagcggtccaaatggtgcaggca
gggttaaaggcgatctatgccagtggctggcaggtggctgctgacgcaaatgacgccctg
caaacgtatccagaccaaagcctttatcctgtgcagagcatgccgcatttaatcaggcgg
atcaacaacgcgctgaaacgtgcagatcagatccagcatatgcagaacaaagtaaatgga
gattggtttgttccgatcatcgcagatgctgaggcgggattcgggggcaatttgaacacc
tttgagttgatcaaggcaatgatcgaagcaggatctgcagccattcatctcgaagatcag
ctctcttcgcagaaaaaatgcggccatatggggggcaaggttcttgtttcaggtgatgcg
tttattgaaaaattgatggctgcgcgccttgcagctgatgtcatgggaattcccacgtta
atcatagcaagaaccgacgcgcattctgccaaattgatccgctccgattcctattcggta
gaccggccgtttttaacaggggaacgctctgtggaaggctttcattatattgaaggggga
atcccttatgcgattgcaagagggcttgattttgctccttattgcgatctggtctggtgt
gaaacatcgacacccgatctgggagaagctagggagtttgcgcaaggaattcatgagaaa
taccccggcaagtggctagcttataactgctctccttcttttaactggaaagcgaagcta
gatgatcgatctatccgggattttcaggaaaagcttggggaaatagggtacaaatttcaa
tttgtcactttggctggatttcatacgttgaacgcttcaatgttcgatttggctagacaa
tacaaagaagaggggatggcggcttattcccgtttccaagaacgggaatttgagttggaa
aggcaaggcggtttcagtgcaattaaacatcagcagtttgtgggagccggttattttgat
atggtgacgatgacgcttagccaaggtcagtcatcgaccacggcgcttgcgggctcgaca
gaagaagagcagttcaacctgtga

DBGET integrated database retrieval system