KEGG   Waddlia chondrophila: wcw_0762Help
Entry
wcw_0762          CDS       T01255                                 

Gene name
glk
Definition
Glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
wch  Waddlia chondrophila
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:wch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    wcw_0762 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    wcw_0762 (glk)
   00052 Galactose metabolism
    wcw_0762 (glk)
   00500 Starch and sucrose metabolism
    wcw_0762 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    wcw_0762 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    wcw_0762 (glk)
   00524 Butirosin and neomycin biosynthesis
    wcw_0762 (glk)
Enzymes [BR:wch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     wcw_0762 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
833310..834290
Genome map
AA seq 326 aa AA seqDB search
MISLCGDIGGTNANLCVSRCSNQIELDCIDHLSTQEYLSFSDLINAYLETCDEKPTSACF
AVAGVVKDQRVEMTNASLVVDAREILANTPLKQVKVINDFDAVGYAINVLDSSDFIVLNE
GEVEKKGVKCALGAGTGLGKSLLLYDEELKSYLPVSSEGGHSDFPVASEEEWIFVENLPQ
ATWENLISGSGIERIYQSLQKHRYPNEPGNMAAKEISEKRHDHELCKETFKWFVKFYARA
ARNFSIELLAKGGVYLAGGIGASNQDVFGSLFMEEFTRHHLPLFRELLRKIPVNLITNYE
ISLKGAAFAQVVHSENTSVTHIPSRN
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgataagcttatgtggagatatcgggggaacaaacgcgaatttatgcgtttccaggtgc
agcaatcagattgagctcgactgtatcgaccatctttctacacaggaatacctctctttt
tccgatctgattaatgcttatttagaaacttgcgatgaaaaaccgacctctgcctgtttt
gccgtcgcaggcgttgttaaagatcaacgggttgaaatgacaaatgccagcttggtggtc
gatgctagggaaatccttgcgaatacgccgcttaaacaagtaaaagtgatcaacgacttt
gatgccgttggttacgcaatcaatgtgttggattcctccgattttattgtattgaatgaa
ggggaagtcgagaagaaaggggtgaagtgtgctttgggggcagggacagggcttgggaaa
agcttattgttgtacgatgaggaattgaagtcgtaccttcctgtctcttcagagggtgga
cactccgattttcctgttgcatcggaagaggaatggatatttgttgagaatttgccgcag
gcgacttgggaaaatttgatttcaggcagtggaattgagcgtatttatcaatcgttgcaa
aagcatcgatatcccaatgagcctggaaacatggcagcaaaagaaatttcagaaaagcgg
catgaccatgagttgtgcaaggaaacatttaagtggtttgtgaaattttatgcccgcgct
gcgcgtaatttttccattgagttgctggctaaaggaggggtatatctagctggaggaatc
ggcgcctcgaaccaggatgtatttggcagcttatttatggaggagtttactcggcaccat
ctgcctcttttcagagagttgttgcgaaaaatccctgtcaatttgatcacaaattacgag
ataagtcttaagggagccgcttttgctcaagtcgtgcattcggagaacacatcggtaacc
cacattccctcgcgcaattga

DBGET integrated database retrieval system