KEGG   Waddlia chondrophila: wcw_0772Help
Entry
wcw_0772          CDS       T01255                                 

Gene name
recD3
Definition
exodeoxyribonuclease V, alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
wch  Waddlia chondrophila
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:wch00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    wcw_0772 (recD3)
Enzymes [BR:wch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     wcw_0772 (recD3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(841723..843897)
Genome map
AA seq 724 aa AA seqDB search
MDQIKGYIERITFQSRENGYTVVKMQQPGQSDLTCVVGFMPSVQPGETISCTGSWKKHPA
HGLQFEAKEYRTEAPADLNGVKKYLGSGLIKGIGPVYAERIVSTFGTETLDVIDLEPERL
LEVPGLGEKRVDMIRQCWEEQKSVRDVMIFLQAHNVSPVYAQKIFRVYGKKCIQVVSEAP
YSLAKDIHGIGFKTADKIAEKIGIEKNSPQRIEAGILYVLSELSNDGHVCFPRDPFIEEA
AKILEVDSSLIIKNIENLQEESIVIQEQVHHGALQTFLWLKPLYIAEKGIAKELLRVMQG
ASHLRRIDGEKALEWVQEKLSITLADNQKTAVFLALSEKAQIITGGPGTGKSTITNAILT
ISSKLSDKILLAAPTGRAAKRMSEITGKKAQTIHSLLEFDFRAGGFKRNGKNPLDCDLLI
IDEASMIDTLLMYSLLKAVPDHSRLIFVGDIDQLPSVGPGNVLKDMIASRTLAVTQLNQI
FRQASGSRIVTNAHRINKGIFPELYNGKESDFFFIAEEDKDALLNQILTLAAQRVPRTYH
FDPFTDIQVLAPMKKGVIGTDNLNHLLQETLNPSQNHIYKYGRRFAKGDKVMQTRNNYDK
KVYNGDVGRIEKIDETDQKVYVKMEDLLISYDFADLDELVLAYAVSVHKYQGSECPCIIM
PVHTSHFKLLHRNLLYTGVTRGKKLVILAGTKKALAIAIHNDEVKSRYTGLLASLLEKHN
PALD
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggatcagatcaaaggatacatcgaacggatcacttttcaaagccgggaaaatgggtat
accgtcgtcaaaatgcagcagccaggccagtccgatctgacctgtgtcgtcggatttatg
ccttctgttcaaccgggtgaaacaatcagctgtacgggaagttggaaaaagcatccagca
cacggactgcaattcgaagccaaagagtacaggacagaagctcctgccgatctaaacggc
gtcaaaaaatatctgggttccggcctgatcaaagggatcggtcccgtttatgctgagaga
atcgtcagtacattcggcacggaaacactggacgtgatcgacttagagcccgagcgtctg
ctggaagtaccggggcttggagaaaaacgggttgacatgatccgtcaatgctgggaagag
caaaaatctgtcagagatgtcatgatctttttgcaagcccataacgtcagccctgtctat
gcccaaaaaatcttccgcgtctatggaaaaaaatgtattcaagtggtctccgaggccccc
tattcgcttgccaaagacatccatggaatcggatttaaaactgcagacaaaattgcggaa
aaaatcgggatcgaaaaaaattccccacaaagaattgaagcaggcattctctatgttctt
tctgagctatccaatgacggccatgtctgttttccccgcgatccattcatcgaagaagca
gcgaaaatactagaagtggacagctctctcatcataaaaaacatcgaaaatctgcaagaa
gagagcatcgtgatccaggaacaggtgcatcatggcgcgctgcaaacgtttttatggctg
aaacctctttatattgctgaaaaaggaatcgccaaggagcttctcagagtcatgcaaggc
gcctctcatttaagacgtatcgatggggaaaaagctttagaatgggttcaggaaaagctt
tcaatcactcttgcagacaatcaaaaaaccgctgtttttctggcgctttccgaaaaagcg
cagatcatcacaggaggcccaggaacaggtaaaagcacaatcacaaatgcgatcctaacc
atttcatccaaattatccgacaaaatccttttagcagcgcccaccgggcgggcagccaag
cggatgagcgaaatcacgggtaaaaaagcacaaacaatccacagccttctagaatttgat
ttccgcgccggaggcttcaaaagaaacggaaaaaatccgctcgactgcgatcttctgatt
atcgatgaagcaagcatgatcgacacccttctcatgtacagcttgctaaaagctgttccg
gaccactcccgtttgatcttcgttggagatatcgaccagctgcccagcgtgggcccagga
aatgtactcaaggacatgatcgcctcccgcacgcttgcggttacccaactcaaccaaatt
ttcagacaagcttccggatccaggattgtcaccaatgcccacaggatcaacaaaggaatt
tttcccgaactttacaacggaaaggagagcgacttcttttttattgccgaagaagataaa
gacgcactactcaatcaaatcctaaccctggcagcgcaacgcgttcccagaacttatcac
ttcgacccttttacagacattcaagtgctggctccaatgaaaaaaggagtcattggaaca
gacaacctcaatcatcttttgcaagaaacattaaatcctagccaaaaccacatttacaaa
tacgggcgccgctttgctaaaggagacaaagtgatgcagacccgaaacaactatgacaaa
aaagtctataacggagatgtcggtagaatagaaaaaatcgatgaaacagatcagaaagtt
tatgtaaaaatggaagatctgctgatctcttacgattttgccgatcttgatgaactggtc
cttgcctacgccgtttctgtgcataagtaccagggaagcgagtgtccctgcatcatcatg
cccgtgcatacttcccacttcaaactcctgcaccgcaatctcttatatacaggagttaca
agaggaaaaaagctagtcatccttgcaggaacaaaaaaagcgctggcgatagccatccac
aacgacgaagtgaaaagccgatatacaggccttttggcctctcttttggaaaaacacaac
cctgcgttagattaa

DBGET integrated database retrieval system