KEGG   Waddlia chondrophila: wcw_0807Help
Entry
wcw_0807          CDS       T01255                                 

Definition
disulfide bond isomerase (EC:5.3.4.1)
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
wch  Waddlia chondrophila
Brite
Enzymes [BR:wch01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     wcw_0807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(874134..875189)
Genome map
AA seq 351 aa AA seqDB search
MHHDTLRRSLFEMKGYLFLTIFLLAALPILESSEQKNGIAWHTNYEKALQESKATSKPIF
LFFTGSDWCGWCKKLENEVLNTQEFAEAIGNKMIFVVLDYPMKKNLDAKTREQNQTLKER
YSIKSYPTVVLINGNEELIGTTGYLSGGGQKYAQHLIKMVQEFTAYKQKMRRPSLREYSG
KELKRLYQKSQELGLAADSDKLVQAGIHSDLPHFFLTERYRILLKNGLLHSEEAAAIKEQ
LLVNDPNNKHLTHYQVAIAEFECLSKELESKKVNADAVVYPLVNYINQFKEKDIENTWKL
DMVISQVYLDENQLEKSLKFAQDACAHAPPAIQKEISQAVNKIQEQISEVR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcatcatgataccttacgaaggagtttatttgaaatgaaaggttatctatttttaacc
atctttctcttagctgcgctgccgatactggagtcaagcgaacaaaagaacgggattgca
tggcacacaaattacgaaaaagcattacaagagtcgaaagccacatcgaagccgattttt
ctgttttttaccggctcagactggtgcggatggtgcaaaaaacttgaaaatgaggtgctg
aatactcaggaatttgcagaggcgattggaaacaaaatgatttttgttgttttagactat
ccaatgaaaaagaacctcgatgcaaaaactcgcgaacagaaccagacgctaaaggagcgt
tattccatcaaaagctacccgacagttgtcttgatcaacggcaacgaagaattgatcgga
acgacaggctatctctctggtggcggacaaaagtatgctcaacatctaatcaaaatggtg
caagagttcacggcatacaaacaaaaaatgcgcaggccctccctgcgcgaatattctgga
aaggaactgaaaagactctatcaaaaatctcaagaactaggccttgccgccgactccgac
aaacttgttcaagctggaatccactcagaccttccccatttttttttgactgaacgttac
cgcatattgctcaaaaacggccttctacattctgaagaagctgctgcgattaaagagcaa
ctccttgtcaatgatccaaacaataaacatttaacgcattatcaagtcgccattgcggaa
ttcgagtgcttgagcaaagaattagaatcgaaaaaagtcaacgcagacgcggtggtctat
cctttagtcaactatatcaatcaatttaaggaaaaagatatcgaaaacacttggaaactg
gatatggtcatctctcaagtgtatttggatgaaaatcaacttgaaaagtccttgaaattt
gcgcaagacgcctgtgcgcacgcccctcctgctattcaaaaagaaatctcccaggcagtt
aacaagattcaagaacaaatttcagaagtgcgctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system