KEGG   Waddlia chondrophila: wcw_0998Help
Entry
wcw_0998          CDS       T01255                                 

Gene name
sucB
Definition
2-oxogluturate dehydrogenase complex E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
wch  Waddlia chondrophila
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:wch01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:wch00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:wch00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1074122..1075213
Genome map
AA seq 363 aa AA seqDB search
MKEEIKVPAMGESITEATVGQILKPSGSHVKMDEEILELETDKVNQVLYASQTGVLTLTV
ETDDVVKIDQVIGLIDSDGGKPEKKEEKASAPVLKKEEKKPEKGIRHSREAFVAEIGKQE
KSAPPPTMKKERGETRRRMTKIRKVIAKRLVEAQAATAMLTTFNEADLSQVMKLRTKYKE
AFIKEHDAKLGFMSFFVKAVVSALETFPDINSYIDGDEIVHRDYYDIGIAVGTERGLIVP
VLRDCDQKNFADIEKGIIEFAEKARAGTISVDDLQGGGFTITNGGIYGSMLSTPILNHPQ
VGILGMHNIQKRAVVVNDEIVIRPMMYLALSYDHRIVDGKEAVSFLVHVKNCLEDPSRLL
LGV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagaaataaaagttcctgcgatgggggagtcgattacagaagcgacagttggt
cagattttgaaaccttcaggatcgcacgtgaaaatggatgaggagatcctcgaactggaa
acagataaagtcaatcaagttttgtatgccagtcagacaggtgtcttgacgttgacagtt
gagacagacgatgtcgtgaaaatcgaccaggtgattggcttaattgacagcgatggtggg
aaaccggagaaaaaagaagaaaaagcgtccgcgcctgtccttaaaaaagaagagaagaag
cctgaaaaggggattaggcactctagagaagcgtttgttgcggaaatcggcaagcaggaa
aagtcagcgccgccgccaaccatgaaaaaagaacgaggcgagacacgccgccgcatgact
aaaatccgcaaggtaattgcaaagcggctagtggaagctcaagcggcaactgcgatgctt
acgacattcaatgaagcggatctttcacaggtgatgaagctgcgtaccaagtataaggaa
gcgttcatcaaagagcatgatgcaaagctcggattcatgtcttttttcgttaaggctgtt
gtctctgctctggaaacttttcccgatattaactcctatattgacggagatgaaattgtt
catcgagactattacgatatcggcattgccgttggaacagagcgcggactcattgttccg
gttttgcgtgattgcgatcagaaaaattttgccgacatcgaaaaggggattatcgagttt
gcggaaaaagcgcgcgcaggcacaatttccgttgacgaccttcaaggaggtggatttacc
attactaatgggggaatttacggttccatgctttcaacaccgattttaaaccacccgcag
gtggggatattaggaatgcacaacattcaaaagcgcgcggttgtcgtaaatgacgagatt
gtcattcggccaatgatgtatttggcgcttagctacgaccatcgcattgttgatggaaaa
gaggcagtttctttcctcgttcatgtcaagaactgcctggaagatccatccagattgcta
ttgggagtgtaa

DBGET integrated database retrieval system