KEGG   Waddlia chondrophila: wcw_0998Help
Entry
wcw_0998          CDS       T01255                                 

Gene name
sucB
Definition
2-oxogluturate dehydrogenase complex E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
wch  Waddlia chondrophila
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:wch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    wcw_0998 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    wcw_0998 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    wcw_0998 (sucB)
Enzymes [BR:wch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     wcw_0998 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1074122..1075213
Genome map
AA seq 363 aa AA seqDB search
MKEEIKVPAMGESITEATVGQILKPSGSHVKMDEEILELETDKVNQVLYASQTGVLTLTV
ETDDVVKIDQVIGLIDSDGGKPEKKEEKASAPVLKKEEKKPEKGIRHSREAFVAEIGKQE
KSAPPPTMKKERGETRRRMTKIRKVIAKRLVEAQAATAMLTTFNEADLSQVMKLRTKYKE
AFIKEHDAKLGFMSFFVKAVVSALETFPDINSYIDGDEIVHRDYYDIGIAVGTERGLIVP
VLRDCDQKNFADIEKGIIEFAEKARAGTISVDDLQGGGFTITNGGIYGSMLSTPILNHPQ
VGILGMHNIQKRAVVVNDEIVIRPMMYLALSYDHRIVDGKEAVSFLVHVKNCLEDPSRLL
LGV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagaaataaaagttcctgcgatgggggagtcgattacagaagcgacagttggt
cagattttgaaaccttcaggatcgcacgtgaaaatggatgaggagatcctcgaactggaa
acagataaagtcaatcaagttttgtatgccagtcagacaggtgtcttgacgttgacagtt
gagacagacgatgtcgtgaaaatcgaccaggtgattggcttaattgacagcgatggtggg
aaaccggagaaaaaagaagaaaaagcgtccgcgcctgtccttaaaaaagaagagaagaag
cctgaaaaggggattaggcactctagagaagcgtttgttgcggaaatcggcaagcaggaa
aagtcagcgccgccgccaaccatgaaaaaagaacgaggcgagacacgccgccgcatgact
aaaatccgcaaggtaattgcaaagcggctagtggaagctcaagcggcaactgcgatgctt
acgacattcaatgaagcggatctttcacaggtgatgaagctgcgtaccaagtataaggaa
gcgttcatcaaagagcatgatgcaaagctcggattcatgtcttttttcgttaaggctgtt
gtctctgctctggaaacttttcccgatattaactcctatattgacggagatgaaattgtt
catcgagactattacgatatcggcattgccgttggaacagagcgcggactcattgttccg
gttttgcgtgattgcgatcagaaaaattttgccgacatcgaaaaggggattatcgagttt
gcggaaaaagcgcgcgcaggcacaatttccgttgacgaccttcaaggaggtggatttacc
attactaatgggggaatttacggttccatgctttcaacaccgattttaaaccacccgcag
gtggggatattaggaatgcacaacattcaaaagcgcgcggttgtcgtaaatgacgagatt
gtcattcggccaatgatgtatttggcgcttagctacgaccatcgcattgttgatggaaaa
gaggcagtttctttcctcgttcatgtcaagaactgcctggaagatccatccagattgcta
ttgggagtgtaa

DBGET integrated database retrieval system