KEGG   Waddlia chondrophila: wcw_1042Help
Entry
wcw_1042          CDS       T01255                                 

Definition
DNA polymerase III, chi subunit
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
wch  Waddlia chondrophila
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:wch00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    wcw_1042
   00240 Pyrimidine metabolism
    wcw_1042
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    wcw_1042
   03430 Mismatch repair
    wcw_1042
   03440 Homologous recombination
    wcw_1042
Enzymes [BR:wch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     wcw_1042
DNA replication proteins [BR:wch03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     wcw_1042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1122243..1122671)
Genome map
AA seq 142 aa AA seqDB search
MRFFKMNIRFLKTTDNVTKLRRISASVEHYFLKKKRVLITVPSETAATYLDDFLWKQPKE
GFLPHSVSTQACSDEIVITTKQENLNQAEILINLCSEFSPIAGQFKTVFELWDETNALRR
EQSEKKFKAYEASGMKVELFRC
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgagattcttcaagatgaacatccgatttctgaagacaacagataatgttacgaaattg
cggcgtattagcgcttcagtagagcactattttcttaagaaaaaacgcgtactgattact
gtcccctcagaaactgccgcaacctatctagatgattttttatggaagcagccaaaagag
ggtttcctgccgcattctgtctcgacacaagcttgttcagacgagattgtgattacaacg
aaacaggaaaatcttaatcaagctgaaattctcattaatctttgttctgagttttcgccg
attgccggacagtttaagactgtgttcgaattgtgggatgaaacaaatgcattgcgacga
gagcagtctgaaaaaaagtttaaagcttacgaagcttcagggatgaaagttgaattattt
cgatgttga

DBGET integrated database retrieval system