KEGG   Waddlia chondrophila: wcw_1155Help
Entry
wcw_1155          CDS       T01255                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
wch  Waddlia chondrophila
Pathway
wch00010  Glycolysis / Gluconeogenesis
wch00051  Fructose and mannose metabolism
wch00562  Inositol phosphate metabolism
wch01100  Metabolic pathways
wch01110  Biosynthesis of secondary metabolites
wch01120  Microbial metabolism in diverse environments
wch01130  Biosynthesis of antibiotics
wch01200  Carbon metabolism
wch01230  Biosynthesis of amino acids
Module
wch_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:wch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    wcw_1155 (tpiA)
   00051 Fructose and mannose metabolism
    wcw_1155 (tpiA)
   00562 Inositol phosphate metabolism
    wcw_1155 (tpiA)
Enzymes [BR:wch01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     wcw_1155 (tpiA)
Exosome [BR:wch04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   wcw_1155 (tpiA)
  Exosomal proteins of bladder cancer cells
   wcw_1155 (tpiA)
  Exosomal proteins of melanoma cells
   wcw_1155 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADI38512
UniProt: D6YWK1
Position
complement(1234710..1235474)
Genome map
AA seq 254 aa AA seqDB search
MPREVIIAGNWKMYKDRREGKDFLSKFASAVSDAPHTVYLAPPFPLIAFLSRQAEGTNLL
IGAQNMHDAEEGAYTGEVSAKMLLDAGAEFVILGHSERRRCFGEDNAFINRKVKRALESG
LRPIVCIGETEEERSCGKTEEVLHEQLSDSLAGLSSEQVSRSVIAYEPVWAIGTGLTATP
GQAQDAHAFCRSVVKMLWGEEVSEGISILYGGSVKPDSARVMMEQSDVDGVLVGGASLDP
ETFAQIVNYQTMKG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgggaagtgatcatcgctggaaactggaaaatgtacaaagaccgcagggaaggg
aaagattttctgtcgaaatttgcttctgccgtatccgatgcgccgcatacagtgtatctt
gctcctccgtttcctttgatcgctttccttagcaggcaggccgaagggacgaacctcttg
attggagcccaaaatatgcatgacgcagaagagggtgcttatacaggagaagtgtctgcg
aaaatgctgttggatgccggagctgagtttgtcattttaggacactctgaaaggcggcgc
tgctttggtgaagataatgctttcatcaataggaaggtgaagcgcgctttggaaagcgga
ctccgcccgatagtttgcatcggagaaacagaagaggagaggagttgcggaaaaaccgaa
gaagttctgcacgaacagttatccgatagcttggcaggcctttcttccgaacaggtttcc
cgttctgtgattgcttatgagcctgtttgggcaattggtaccggcttgactgcaactcca
ggccaagcgcaggacgcccatgctttttgccgttccgtggttaaaatgttatggggagaa
gaggtttccgaaggcatttccatcctttatggagggtcggtaaaaccggacagcgcgcgc
gtgatgatggagcagagcgatgtggatggcgttttagtgggcggagcctcgctggatccg
gaaacatttgctcaaatagttaattatcagacgatgaagggatag

DBGET integrated database retrieval system