KEGG   Waddlia chondrophila: wcw_1274Help
Entry
wcw_1274          CDS       T01255                                 

Gene name
fadB
Definition
Fatty acid oxidation complex, alpha subunit FadB (EC:5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
wch  Waddlia chondrophila
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:wch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    wcw_1274 (fadB)
   01212 Fatty acid metabolism
    wcw_1274 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    wcw_1274 (fadB)
   00650 Butanoate metabolism
    wcw_1274 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    wcw_1274 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    wcw_1274 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    wcw_1274 (fadB)
   00310 Lysine degradation
    wcw_1274 (fadB)
   00380 Tryptophan metabolism
    wcw_1274 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    wcw_1274 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    wcw_1274 (fadB)
   00281 Geraniol degradation
    wcw_1274 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    wcw_1274 (fadB)
Enzymes [BR:wch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     wcw_1274 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     wcw_1274 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     wcw_1274 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1351510..1353654)
Genome map
AA seq 714 aa AA seqDB search
MGKAFHLTIDPNGIARLAFDYPGEKVNKISLEVLEELDAVLEGIKDNQQIKALVITSAKE
KIFIAGADLKSFERLFKNFDLAEGMIKKGHSVYNKLEELPFPSIAVIDGVCLGGGLELAL
ACTYRVVGDSSKTTLGLPETNLGIFPGWGGTQRLPRLVGLMEGLKMVLTGRPVDAKKAFK
IHLADAIFPSEFMKEKTDAFVEEILTSKGKEKVLERRKSRGLMSLLFERNPIGRAFVFWQ
SRRSVLQKTKGQYPSPLAALDLIQNTYTMPLKKGLKKEVEAFVKSMSGAFQCAPNLIYIF
FNSEQMKKDPGMIGGQATGKEVKSVGVLGAGVMGSGIAWLMSYRDLPVRMKDVNWKAVGS
GFKSAWDTYKVLIKKRKLKPAQANRKFHLISGTIDYTGFDKLDFVIEAAVENLELKHKIL
KELEANVRPDAIIATNTSSLTIDELAPALKHPERLVGMHFFNPPARMPLVEIVSGEKTSP
EAVQTVFELCQRLKKTPVVVGDCSGFLVNRVFAHGFVEIMRMLEEGVPQERLDKLFLKFG
LPMAPFVLADEIGNDVNLKAMKSFESAYGIRMEVPKLLEKLNEKQLYGRKVGKGFYIYDK
KSKKINPEITSFLPHQNGMNISDTDAIDRVMLAMINEAARCLQENVIHNPGYLDMALVFG
VGFPPFRGGLLRYADSIGIEKLMDKYGHLVSTYGERFVPCEKLKEMQASRRGFF
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagcatttcatttaacaattgatccgaatggaattgcgcggttggcttttgat
tatccgggtgaaaaagtgaataaaatctctctagaagttcttgaagagctggacgctgtt
ttggaagggataaaagataatcaacagatcaaggctttagtcattacaagcgctaaggag
aaaatctttattgccggagcggatttaaagagttttgaaaggctgtttaaaaattttgat
ctggcggaagggatgattaaaaaaggacatagtgtctacaacaagctggaagagctgcct
ttcccatcgatagctgtcattgatggcgtgtgccttggaggagggctggagcttgctcta
gcctgcacttacagggttgtcggagacagttcaaagacgactcttggcttgcctgaaacc
aatttggggatttttcccggatggggcggcacgcagaggctgccgcggcttgtcggcttg
atggaagggttgaagatggtgttgacaggccggcctgtcgatgcgaaaaaagctttcaaa
atccatcttgccgacgccatttttccttctgaatttatgaaggagaaaaccgacgcgttt
gtcgaggaaattctgacttctaaagggaaagagaaggttttagaaagaaggaagtcaaga
ggattaatgtctttgttgttcgaacgcaatcccattggcagagcctttgtcttttggcaa
agcaggcgaagtgttctgcaaaagacaaaagggcagtatccctcgcctttagctgcgctt
gaccttattcagaacacgtatacgatgccgcttaaaaaaggattgaaaaaagaggttgag
gcttttgttaaatcgatgtcgggagcttttcaatgtgcgcccaatttgatctatattttc
tttaactcggagcagatgaaaaaagatcctgggatgattggcggccaagcaacgggaaaa
gaggtaaagtcggtcggcgttttgggagcaggggtgatgggaagcggcattgcctggcta
atgagctatcgcgatcttcctgtccgaatgaaagatgtcaattggaaagctgttgggagc
gggtttaaatctgcttgggatacatacaaagttctcattaaaaaaagaaagcttaagccg
gcgcaagccaatcgcaaatttcacttaatttccgggactatcgattatacagggtttgac
aagctcgattttgtgattgaagcggcggtggaaaatttggagctcaaacataaaattctc
aaagaacttgaggctaatgtgcggcctgatgcgattatcgcgacgaatacatcttctttg
acaatcgatgaattagcaccggcgttgaaacatccggaaagattggtcggcatgcatttt
ttcaatccgccggcccgcatgccgttagttgagattgtgtccggagaaaaaacctcgccg
gaagctgtgcaaacagtctttgaattgtgtcagcgtttaaaaaagactcccgttgtcgtt
ggcgactgttccggcttccttgtcaaccgcgtttttgcccatggctttgtcgagatcatg
cggatgcttgaggagggggttcctcaagagaggctcgataagttattcttgaagttcggc
ttgccgatggcgccgtttgtccttgccgatgaaattggcaatgacgttaacttaaaagcg
atgaaaagttttgaaagcgcttacggcatacggatggaggttcccaaacttcttgaaaaa
ttgaatgaaaagcagttgtatgggagaaaagtgggcaaaggcttttacatctatgataag
aaatcgaaaaaaatcaatccggaaatcacctcttttcttccccatcagaatggaatgaac
atttcagacacagatgcaattgatcgcgtgatgcttgcgatgatcaacgaagctgccagg
tgtttgcaggaaaatgtcattcacaatccaggctaccttgatatggctttggtgtttggt
gtcggatttcccccttttcgaggcggacttctccgttatgcggactctattggtattgag
aagttgatggataaatacggtcatcttgtgtcgacttatggggagcggtttgtcccttgt
gaaaaattgaaggagatgcaggcatccaggcgtgggtttttctag

DBGET integrated database retrieval system