KEGG   Waddlia chondrophila: wcw_1295Help
Entry
wcw_1295          CDS       T01255                                 

Gene name
glpK
Definition
Glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
wch  Waddlia chondrophila
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wch00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    wcw_1295 (glpK)
Enzymes [BR:wch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     wcw_1295 (glpK)
Exosome [BR:wch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   wcw_1295 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1384940..1386397
Genome map
AA seq 485 aa AA seqDB search
MDHTEMKYIMTLDQGTTGIKVCLYDKQGQAVAKSTKNIEQIFPKPGWVEHCPKQLWESTL
PLADQTLAQAKTSWNEIAAIGITNQRETTILWDEKTGIPLYNAIVWQCRRTAFLCEQLKN
AGHEARIREKTGLVLDPYFSATKIRWILDHAKNIPTTTKFGTVDSWIIWNLSGKTTHVTD
PTNASRTLLFNIHSKQWDDELLNLFKIGKEILPKVKTCRFAMTDSHLTGGVSIPIAGVAG
DQQSALFGQKCWKTGEAKSTYGTGIFIVMNEGKQLSDTPKGLLATLAYNGQREMCYATEG
SIFMAGATLEWLKNKLQIIKSPQEADQLASSIPDNGGVYLIPAMAGLGAPQWNPEARGII
SGLTQGSGRAQIARAALEAMAYQTRDVFEEMSRPVSKLKVDGGVTKSNFLMQFLADQLSI
SVIRSKDTDLTSRGAGYLAGLNVGFWESCEEILSLNEESEEVTPSLQNGEENYRLWKRAF
SAIDG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggatcatacagaaatgaagtacattatgactcttgaccaaggcacaaccggaatcaaa
gtttgtttgtacgacaagcagggacaagccgttgctaaaagtacaaaaaacattgaacaa
atctttcccaaaccgggctgggttgagcattgccctaaacagctttgggagtcaaccctt
ccgctagccgatcaaaccttggcacaagctaaaacgagctggaatgagatcgctgctatt
ggaatcacaaatcaaagggaaacaacgattctttgggacgaaaaaacaggcattcctctt
tataacgcaattgtctggcaatgccgtcggaccgcttttctttgcgaacagttaaaaaac
gccgggcatgaagcacgaattcgagaaaaaactggattagtgctcgacccttatttttct
gctacaaaaatccgatggattctcgatcacgcaaaaaacattccaacaacgaccaaattt
ggaaccgttgatagctggatcatttggaatctgagtggaaaaacaacacatgtgaccgat
ccgacaaacgcttcccgcaccctgctattcaatattcattccaagcaatgggacgacgaa
ctccttaacctcttcaagatcggcaaagagatcctgcctaaagtaaaaacgtgcagattc
gccatgacagattctcacttaaccggaggagtttccattcctatcgccggcgttgcagga
gaccaacagtctgcattgttcggacagaaatgctggaaaacgggtgaagcaaaaagcact
tacggtacaggaatctttatcgtcatgaacgaagggaagcagctgtccgatactccaaaa
ggacttctggcaacattggcatacaatggccagagagaaatgtgttacgcaaccgaaggg
tcgattttcatggcgggtgccactcttgagtggcttaagaacaaactgcaaatcatcaaa
tctccgcaagaagccgatcaactagcttcatccatccccgataatggcggcgtctattta
atccctgcaatggctggtctgggagcccctcaatggaatcctgaagcgcgaggaataatc
agcggtctgacgcaaggatctggcagggcgcaaatcgcgcgtgcagcgcttgaggcgatg
gcctaccagacacgtgatgtttttgaggagatgagccgccctgtttccaaacttaaagtt
gacggcggagtcactaagtcaaatttcctgatgcagtttttggcagatcagttgagcatc
tcggtgattagatcaaaagacaccgatctcacatcccgcggcgccggatatcttgcaggt
ttgaacgttgggttttgggaatcctgcgaagagatcctttcgttaaacgaagaaagcgaa
gaggttaccccctcccttcaaaacggcgaagaaaactaccgtttatggaaacgtgccttc
tcagcaatagacggatag

DBGET integrated database retrieval system