KEGG   Waddlia chondrophila: wcw_1391Help
Entry
wcw_1391          CDS       T01255                                 

Definition
fatty-acid desaturase (EC:1.14.-.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
wch  Waddlia chondrophila
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:wch01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:wch01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1483091..1484224
Genome map
AA seq 377 aa AA seqDB search
MIDTSRGINWGPAAFIILYHIGLLCALPFYFYYHTPSLSLILISIGIFYLTGVSITAGYH
RYFSHKSYKAHPVIEAILVFLGSMTAQGSVLRWSFDHRLHHAHVDTDNDPYSIKKGFWYA
HCLWILEKPREIESKLVCDLERKKLVMLQHRYYPFMMVFTNAIATLFVGWLLNDYLGAFV
ISLWVRLFFLHHFTWFINSLAHTWGDKPFCTEQTAVNNFVISLVTFGEGYHNYHHTYAND
YRNGIRWYHFDPTKWLIWTLNRFGLTKDLKRMDPYTIKKKMILERKGLLTKQLKDLWYIK
KEELEKNIQEVSDRILEQIADFKKLSEKYRTAKKEQQHELLIHLKQEIKQLKKSLKSDWR
HWKRLSSNIMGLKPLPV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgattgatacttccagaggaatcaattgggggcctgcagcctttatcatcctttaccac
atcggcttgctgtgcgcactccccttttatttctattatcacaccccttccctctcttta
attttgatcagcattggaattttttacttaacgggagtcagcataacggccggatatcat
cgatatttctcgcacaaatcttataaagcgcatcccgttattgaagcgattctggttttt
ctgggttcaatgacggcgcaaggcagcgtgctgcgctggtcgttcgaccaccgcctccac
catgctcatgtcgacactgataacgatccttattcgatcaaaaaaggtttttggtacgct
cattgcttgtggattcttgagaagcctcgtgaaatcgaatcaaagcttgtatgcgatttg
gagcgaaaaaaacttgtcatgctccagcaccgctattacccgtttatgatggtgtttacc
aacgctattgcaacgctgttcgtgggctggttgctcaatgactatctaggcgcatttgta
atctctctttgggtgcgcctttttttcctccaccacttcacctggttcatcaactctctt
gctcacacttggggagacaagcctttctgcacagagcagacagctgtgaataacttcgtt
atttcccttgtcactttcggagagggttatcataactaccaccacacctacgccaacgac
taccgcaacggaatacggtggtatcatttcgatccgactaaatggttgatttggacgctg
aacagattcggcctgaccaaggatctgaagcggatggacccttacacgatcaagaagaag
atgattcttgagcggaaagggctgctcaccaaacagctcaaggacctttggtatattaaa
aaggaagaacttgaaaagaatatccaagaggtttcagacaggattttggaacagattgcc
gacttcaaaaaattatcggagaaatacaggactgccaaaaaagaacagcaacacgagctg
ctcatccacttaaagcaagagatcaaacagctcaaaaagagccttaaatcggactggcgt
cattggaaaaggctttcaagcaacatcatggggcttaagccgctgcctgtatag

DBGET integrated database retrieval system