KEGG   Waddlia chondrophila: wcw_1391Help
Entry
wcw_1391          CDS       T01255                                 

Definition
fatty-acid desaturase (EC:1.14.-.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
wch  Waddlia chondrophila
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:wch00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    wcw_1391
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    wcw_1391
Enzymes [BR:wch01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     wcw_1391
Lipid biosynthesis proteins [BR:wch01004]
 Desaturase
  First
   wcw_1391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1483091..1484224
Genome map
AA seq 377 aa AA seqDB search
MIDTSRGINWGPAAFIILYHIGLLCALPFYFYYHTPSLSLILISIGIFYLTGVSITAGYH
RYFSHKSYKAHPVIEAILVFLGSMTAQGSVLRWSFDHRLHHAHVDTDNDPYSIKKGFWYA
HCLWILEKPREIESKLVCDLERKKLVMLQHRYYPFMMVFTNAIATLFVGWLLNDYLGAFV
ISLWVRLFFLHHFTWFINSLAHTWGDKPFCTEQTAVNNFVISLVTFGEGYHNYHHTYAND
YRNGIRWYHFDPTKWLIWTLNRFGLTKDLKRMDPYTIKKKMILERKGLLTKQLKDLWYIK
KEELEKNIQEVSDRILEQIADFKKLSEKYRTAKKEQQHELLIHLKQEIKQLKKSLKSDWR
HWKRLSSNIMGLKPLPV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgattgatacttccagaggaatcaattgggggcctgcagcctttatcatcctttaccac
atcggcttgctgtgcgcactccccttttatttctattatcacaccccttccctctcttta
attttgatcagcattggaattttttacttaacgggagtcagcataacggccggatatcat
cgatatttctcgcacaaatcttataaagcgcatcccgttattgaagcgattctggttttt
ctgggttcaatgacggcgcaaggcagcgtgctgcgctggtcgttcgaccaccgcctccac
catgctcatgtcgacactgataacgatccttattcgatcaaaaaaggtttttggtacgct
cattgcttgtggattcttgagaagcctcgtgaaatcgaatcaaagcttgtatgcgatttg
gagcgaaaaaaacttgtcatgctccagcaccgctattacccgtttatgatggtgtttacc
aacgctattgcaacgctgttcgtgggctggttgctcaatgactatctaggcgcatttgta
atctctctttgggtgcgcctttttttcctccaccacttcacctggttcatcaactctctt
gctcacacttggggagacaagcctttctgcacagagcagacagctgtgaataacttcgtt
atttcccttgtcactttcggagagggttatcataactaccaccacacctacgccaacgac
taccgcaacggaatacggtggtatcatttcgatccgactaaatggttgatttggacgctg
aacagattcggcctgaccaaggatctgaagcggatggacccttacacgatcaagaagaag
atgattcttgagcggaaagggctgctcaccaaacagctcaaggacctttggtatattaaa
aaggaagaacttgaaaagaatatccaagaggtttcagacaggattttggaacagattgcc
gacttcaaaaaattatcggagaaatacaggactgccaaaaaagaacagcaacacgagctg
ctcatccacttaaagcaagagatcaaacagctcaaaaagagccttaaatcggactggcgt
cattggaaaaggctttcaagcaacatcatggggcttaagccgctgcctgtatag

DBGET integrated database retrieval system