KEGG   Waddlia chondrophila: wcw_1787Help
Entry
wcw_1787          CDS       T01255                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase ruvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
wch  Waddlia chondrophila
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:wch03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1904119..1904727)
Genome map
AA seq 202 aa AA seqDB search
MIYFIRGILIQSTPGIAILETGGIGYKVHIPASTYPKLPQIGQEALLHTSMVVREVSQTL
YGFFYSEERDLFEELTTVSGIGPKIALALIGHLSVEEMHAAIGNQEVAMISKVPGIGKKT
AQRLVIELRDKVQKGGKYSLPSDFAIQVGTDSRGQKIADAMSALLNLGYNQSTAQKALKK
SLSNFPETIDLTELITDALKNV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatttattttatccgcggaattcttatccaatcaactccaggcattgcgattcttgaa
acagggggaatcggctacaaggtgcatattcccgccagcacttatcccaagcttccgcag
attggccaagaggctcttcttcacacatctatggtggtgcgagaggtgtcgcagacgctg
tacggcttcttttattcggaggagagagatctattcgaagagctgactactgtgtcagga
atcggccctaagattgctcttgcgctgatcgggcatctgtcggtagaagagatgcatgca
gccattggaaatcaagaggttgcaatgatcagcaaagtgcctggaatcggaaaaaaaacc
gctcaacggttagtgatcgagcttagggataaagtgcagaaaggagggaaatattctttg
ccttccgattttgcgatccaagtcggtaccgattcgcgtggacaaaagattgccgatgcc
atgagcgccttgcttaacttaggatataaccagagcactgctcagaaagcgttgaaaaaa
tctctttcgaattttcctgagacgattgatttaacggagctaatcacggatgctctcaag
aatgtataa

DBGET integrated database retrieval system