KEGG   Waddlia chondrophila: wcw_1880Help
Entry
wcw_1880          CDS       T01255                                 

Definition
(GenBank) putative trehalose synthase/maltokinase
  KO
K05343  
maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
wch  Waddlia chondrophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wch00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    wcw_1880
Enzymes [BR:wch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     wcw_1880
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     wcw_1880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2021756..2024986
Genome map
AA seq 1076 aa AA seqDB search
MTNWYKDAIVYQLHVKCFRDSNKDGIGDFKGLTKKLDYLQNLGCTAIWLLPFYPSPLRDD
GYDIADYLNVHPNYGSLKDFRTFLNEAHKRGLKIITELVINHTSDQHQWFQQSRKGKPGS
QWRDYYVWSDTPDKYSEARIIFKDFETSNWTWDPVAEAYYMHRFYSHQPDLNYENPAVHQ
EIFNILNFWMNMGVDGMRLDAIPYLYKKEGTDCENLPETHQFLKKLRRFVDQNYPDRMLI
AEANQWPEQSAAYFGNDDECHMAFNFPVMPRLYMALQMEDRFPIIDIMEQTPKPPPSCQW
GIFLRNHDELTLEMVTEEERDYMYRSYAIDPQARINLGIRRRLAPLMNNATQKIHLMNVL
LFSLPGSPIIYYGDEIGMGDNYYLGDRDGVRTPMQWNTDRNGGFSDGNPQKLYLPLVIDP
EYHHAFVNVENQEKSPSSLLWWMRKMISVRKRYKAFSRGDIHVLSPSNSKVLAFIREYEK
ESILVLINLSKYPVYVNLNLSQYSGGKLKDIFGNQEFCSIKEGSVGLTVGGYGYYWLAIF
PSDLELPHGDHLEELQLKKSWQDILLPEYEHTFCNRILMNYLPLCRWFQRKADKIIDISI
SDKTAFDSAIFLHLKVDYASHETEYYQLPISFKPGIGHEDYQHGVIAKVRFENTEGLLID
GIFDEEFRSHLLNHLILEKKQLKSRKGSITIQTTAALNKLGKAEGSQFSRVYSAEQTNNS
ISYGDAIIAKFFRKVENGLNPDYEIARHLTQSAKFKQTPRLLGSIQYTIKGKAPSILAMI
QEFVPNGGDMWQHSLDTIRLFFENALIREPGTNFDALEESIGTHFLQTIKLLGIRTAELH
LALSNDYGKEEFKPERFTWMYQKSLFQSIRSQIKKALYLLGQRYQEFDEADQRLAINLLD
KQSEFEKRIADLQTRKIEAKKIRIHGDYHLGQVLYTGNDLAIIDFEGEPVMPLSERKLKK
SPLQDIAGMVRSFHYASIWGFQLFEQYRGDSSSAVLPYRSRWYTTLKDLFISSYSTRLSD
AEPGMIPTNPEDFQTLLFAHLIQKAAYELSYEMQSRTGKVMIPMMGLTELLEEKSG
NT seq 3231 nt NT seq  +upstreamnt  +downstreamnt
atgacaaactggtataaagacgcaattgtctatcaattgcatgtcaaatgctttcgcgat
agcaacaaagacggcatcggcgatttcaaaggactgacaaaaaaactcgattacctgcag
aacttaggatgtacggcaatctggctccttcccttctatccgtctcctctaagagacgat
ggctatgacattgccgactatcttaatgtccatcccaattacggcagcttaaaagatttc
cgcacctttttaaatgaagcgcacaaaaggggccttaaaatcatcacagagcttgtgatc
aaccacacctccgaccaacaccaatggtttcaacaatcccgcaaaggaaaacccggctct
cagtggagagactattacgtttggagcgacacaccggacaaatactctgaagccaggatt
atcttcaaagatttcgaaacttccaactggacttgggatcctgtagcagaggcgtactac
atgcacaggttttattcccatcagcctgatttgaattatgaaaaccctgccgtgcaccaa
gagattttcaatattctgaatttctggatgaacatgggcgtcgacggcatgcggctggat
gcgatcccctatctttataaaaaagagggcaccgattgtgaaaatcttccggaaactcat
caatttttgaaaaagctgcgccgctttgtcgatcaaaactatccggaccgcatgctgatt
gccgaagccaatcaatggccggagcaatcagccgcctattttggcaatgacgacgagtgc
catatggcgttcaattttccggtgatgccccgtctctacatggctttgcaaatggaagat
cgcttccccattatcgatatcatggaacagacccccaagcctcctccttcctgccagtgg
ggaattttcttgcgcaatcacgacgaattaacgctggaaatggtcacagaagaagagagg
gactacatgtaccgttcctacgcgatcgaccctcaagcgcggatcaatcttggtatcagg
agaagacttgcccccttgatgaataacgcaacgcaaaaaatccacctgatgaacgtcttg
ctcttttctcttccgggttccccaatcatctactatggcgatgagattggaatgggcgac
aattactatttgggcgacagagatggagtcagaacaccgatgcaatggaatacggataga
aacggaggattttccgacggcaacccgcaaaagctttatctccctttggtgatcgatccg
gaatatcaccacgctttcgtcaacgtagaaaatcaggagaaaagcccctcttcactgcta
tggtggatgagaaaaatgatcagcgtacgcaaaagatacaaagctttcagccgaggagat
atccacgttctgtccccttctaattcgaaagtgctggcattcattcgggaatacgagaag
gaaagcatcctcgtcttgatcaatctctccaaatatccggtctacgtcaatcttaatctg
agccaatactctggagggaagctgaaagatattttcggcaaccaggaattttgctccatt
aaagagggttccgtcggtttgacagttggaggctacggctattattggctagccattttt
cccagcgatttggagttgccgcacggggatcaccttgaagagcttcaacttaagaaatca
tggcaagacattcttctgcctgaatacgaacacacattttgcaatcgcatactcatgaac
tatcttccgttgtgcagatggtttcaaagaaaggcggataagattatcgacatctccatt
tccgataaaaccgcgttcgattctgccatttttctccatcttaaagtggactatgccagc
catgagacagaatactaccagttgccgattagcttcaaacctggaatcgggcacgaagat
tatcagcacggggtgatcgcaaaagtccgcttcgaaaatacagaggggcttttaatcgat
ggaatcttcgatgaagaattccgctctcaccttttaaatcatttaattctggaaaaaaaa
caattgaaaagccgaaaaggctcaataacaatacaaacaactgcagctttgaacaagctt
ggaaaagcagaaggaagccaattttcaagagtttactccgctgaacagacaaacaattcc
atttcttacggagatgcaatcattgcgaagttcttccgcaaggttgaaaacgggcttaac
cccgactatgaaattgccaggcatttaacacagagcgcgaaattcaaacaaacgccgcgc
ctgctcggctcgattcaatacaccattaaaggaaaagcgccatccatactcgccatgatc
caggaatttgtcccaaatggcggcgatatgtggcaacattcattagatacaatcagatta
ttttttgaaaatgccttaatccgagaacctggaacgaatttcgatgcgctcgaagaatct
atcggaacccattttttacaaacaatcaagctcttaggaattcgaacggccgaactccat
ctcgccttatcaaacgattatggaaaagaggagttcaaaccggagcgcttcacgtggatg
tatcaaaaatcgctttttcaatccattagaagccaaatcaagaaagccctctacctgctt
ggtcaacgttatcaagagttcgatgaagcagatcaacggcttgcaatcaatcttctcgat
aaacaatcagaatttgaaaaacgaattgccgacttgcaaacccgaaaaatcgaagcgaaa
aaaataaggatccatggcgattaccatttgggtcaagttctctataccggcaacgatctt
gccatcatcgatttcgagggagagcctgtgatgccgcttagcgaaagaaagctgaaaaaa
tctccgcttcaggatattgcaggaatggtgcgttcgtttcattacgcatctatctggggc
tttcaattatttgaacagtacagaggagactcttcctccgctgttttgccttacagatcg
cgatggtacacaactctaaaagatctcttcatttcaagctattctacaaggctgtccgat
gcagaacctggaatgatccctacaaatccggaagacttccaaacgctgctgtttgcccac
ctcattcaaaaggctgcctacgaactttcctacgagatgcaaagccgtacaggcaaagtg
atgattcccatgatgggattaacagaattattggaggaaaaaagcggatga

DBGET integrated database retrieval system