KEGG   Waddlia chondrophila: wcw_1881Help
Entry
wcw_1881          CDS       T01255                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
wch  Waddlia chondrophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:wch00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    wcw_1881 (glgB)
Enzymes [BR:wch01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     wcw_1881 (glgB)
Exosome [BR:wch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   wcw_1881 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2024983..2026875
Genome map
AA seq 630 aa AA seqDB search
MKEAVAVYSLLSEKDIYLFKEGTHDRLYEKLGSHVVEVDGIKGTQFAVWAPNAESVSVIG
DFNDWDRKRHQLHVRWDESGIWEGFIPGAKQGDCYKYHIASKVNGYRVEKGDPFAFFAEV
PPKTGSIIWDLAYEWKSLTEERSRSDKPISIYEMHFGSWRRDEKNTPPSYREMAEWLPPY
LLDMGFTHVEFMPMMEHPFYGSWGYQKTGYFSPTSRYGSPQDFMFLIESLHQAGIGVFLD
WVPSHFPSDQHGLAFFDGTHLFEHEDPKKGIQPDWNSYIFNYGRNEVRSFLTSSANFWCS
RYHIDGLRCDAVASMLYLDYSRKNGEWIPNAYGGNENLEAIDFLKTLNTTIYQNHPHVQM
IAEESTAWPMVSRPVYLGGLGFGWKWNMGWMNDTLEYFKKDPVHRKYHHNELIFSILYAF
TESFVLSLSHDEVVHGKASLLTKMPGDEWQKFANLRLLYGYMFTHPGKKLLFMGSEIAPW
TEWHHEAGLEWHILDYERHAGIQRWVRDLNKAYCTLPALHQLDFSEEGFSWIDCSDWENG
VLSYSRKGFDPKDTAVVILNLTPVPRENYKIGVPFSGNWQEVLNSDSHYYGGSDKGNFGR
VASYPIAMHGHDYALSLTLPPLAMICLSPE
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagcagtcgccgtttactcgctactctctgaaaaagatatctatttattcaaa
gaaggaacgcacgatcggctgtatgaaaaacttggatcccatgtggttgaagtagacgga
atcaaaggcacccaatttgctgtctgggctccaaatgccgaatctgtttctgtcatcgga
gacttcaacgattgggatcgaaagagacaccaacttcatgtccgctgggatgagtcggga
atttgggaggggtttattcccggagccaagcaaggagactgctataaataccacattgca
tccaaagtgaacgggtaccgcgtcgaaaaaggggatcctttcgcgttttttgccgaagtc
ccgcctaaaacgggttctattatttgggatcttgcgtacgagtggaaaagcctcacggaa
gaacggagtagatccgacaagccgatcagcatctatgagatgcactttggatcctggaga
agagacgagaaaaacactccgccctcttaccgggaaatggcagaatggctgccgccctat
ctcttagacatgggattcactcacgtcgaatttatgccgatgatggaacatccgttctat
ggatcgtgggggtaccaaaaaactggatatttttcccccacaagccgatatggatcccct
caagattttatgtttctgatcgaatctctgcatcaagcagggatcggcgtcttcttagac
tgggtaccctctcattttccttccgaccagcatggccttgcgtttttcgacggcacacac
cttttcgagcatgaggatcccaaaaaagggattcaacccgactggaacagctacattttc
aactatggacgcaacgaagtacgctcctttttaaccagcagcgcaaatttttggtgcagc
cgctatcacattgatgggcttagatgcgatgcagtcgcctcgatgctctatctcgactac
tcacgcaaaaatggcgaatggattccaaatgcatacggcggaaacgaaaatttggaggcg
atagattttttaaaaactctcaacacaacgatctatcaaaaccatccgcatgtccaaatg
attgctgaagaatcgaccgcctggccaatggtttcacgtcctgtctacctaggagggctt
gggtttggctggaaatggaatatgggatggatgaacgatacactggagtatttcaaaaaa
gatcccgtccatcggaaatatcaccacaatgaattgattttcagcattttatacgccttt
acagagagttttgtcctcagcctttcccacgacgaggttgtgcatgggaaagcatctctt
ctaactaagatgccgggtgacgaatggcaaaaatttgccaaccttagattattatatgga
tacatgttcacccatccgggaaaaaagcttcttttcatgggaagcgaaatcgccccttgg
acggagtggcatcatgaagctggcttagagtggcatatcctggactatgagaggcatgca
ggaattcaaaggtgggtccgagatctcaacaaagcttactgcactcttccggcgctgcat
caactggatttttccgaagagggattttcatggattgattgttcggattgggaaaacgga
gtgctgagttattcaagaaaaggatttgatccgaaggatacggccgttgtgatcttaaat
ttgacgccggtgccgcgtgaaaattacaaaatcggcgttcctttttcaggaaactggcag
gaagtcctgaacagcgactcccactactatggaggctcggacaaagggaatttcggacga
gtggcgtcctatcccattgccatgcatggacacgactacgctttaagcctcacccttccc
cctctggctatgatttgtctgtccccggaatag

DBGET integrated database retrieval system