KEGG   Waddlia chondrophila: wcw_1954Help
Entry
wcw_1954          CDS       T01255                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
wch  Waddlia chondrophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:wch00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2095150..2096727)
Genome map
AA seq 525 aa AA seqDB search
MNNLRFFLSSTPAARQWETIGVRHHHGVCVPLFSLRTHKGEGIGGYLDLIPLISWLKEVH
FDLLQLLPLYDTHGGASPYAPVSSCALNPIYLNLNDLPNAKRSDKREEVLSRLSELNPLP
RVDYALVDQLKTAFLDDYVLNEGEEFFQSRSFEQFVCSQSWLKPYALYKALSSLSGTSDW
KKWKQQWRDPSGNWDRLYEDHRQMLDKHCLIQYFCALQMGEVKKFADSEGVLIKGDCPIL
IGKESADVWADRSLFKVDYRAGAPPDYYNPDGQDWGFPLYRWEAHVAQGFAWWKNRLAAL
EPFCHLYRLDHVVGFYRIWAKWSEGKSGFIPEDSSVWISDGESRLKILLESSDLLPIGED
LGTVPKEVKKSLKHLGICGTKVLRWETEASGKYIPFEEYEPLSMSTLSTHDSETLASWWK
THREDARNFSLFMGWEDESELTFARHLHVLKACHATPSLFHINLIQEYLSLFDELSHSDP
ADERINTPGVDSADNWTYRLRPTIEEIRSHQELQKVMQEISSIRS
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaataatctaagatttttcctatcttccacaccggcggcgcgtcaatgggaaacaatt
ggtgtgcggcatcatcacggggtgtgcgttcctcttttttctctgagaacacataaagga
gaaggaattggaggatatttggatcttattcctctgatttcgtggttaaaggaggtgcat
tttgatctcttgcagctccttcccctttacgacacacatggaggggcttccccttatgct
cctgtttcttcctgtgcgttaaatccgatttatttaaatttgaatgatttaccaaatgca
aaacgttcagataagagagaggaagttctttcccgattaagtgagttaaatcccttgccc
cgtgttgattatgcgcttgtcgatcaactgaaaacagcgtttttggacgactatgtttta
aacgagggggaggagttctttcaaagccgcagttttgagcaatttgtctgttctcaaagc
tggttgaaaccttatgcattgtacaaagcgttgtcatctctttccggaacttctgattgg
aaaaagtggaaacagcaatggcgggatccatcgggtaattgggataggctatatgaggat
caccgtcaaatgctagataagcattgcttaatccagtatttttgtgctcttcagatgggg
gaagtgaaaaaatttgccgattcagaaggcgtcttgatcaaaggggactgcccgattttg
atcggaaaggaaagcgcggatgtttgggctgatcgatccctttttaaagtcgactatcgg
gcgggtgctcctcctgattattacaaccccgacgggcaggattggggatttcctctctat
cgatgggaggcgcatgttgcgcaagggtttgcctggtggaaaaaccgtctggctgcttta
gagcctttttgccatctctatcggttggatcatgtcgttggtttctacagaatttgggca
aaatggagtgagggcaaaagcggttttatacccgaggattcttctgtgtggatttctgat
ggtgaaagtcgattaaagatattgttagagagcagtgatttacttcccattggagaggat
ttgggcactgtgccaaaagaagttaaaaagtctctgaaacacttgggcatttgcggaact
aaagtcttgcgctgggaaactgaagcatcgggtaaatacatcccttttgaagagtatgag
cctttgagcatgtctacgttgtcgactcacgattcggaaacgttggcttcctggtggaag
acgcacagggaagatgcgcgcaatttctccctttttatgggatgggaagatgagtcggag
ctgacatttgcgcgtcatttgcacgttctcaaagcatgccatgcgaccccaagtctgttt
catatcaatctgattcaggaatatcttagcctatttgatgagttgtcccattctgaccct
gcggatgagcggatcaatacccctggagtggattcggccgacaactggacttatcgtttg
cggccgacaatcgaggagatcaggtcgcatcaagagttgcaaaaagtcatgcaggaaatt
tcatctattcgttcttga

DBGET integrated database retrieval system