KEGG   Wigglesworthia glossinidia morsitans: WIGMOR_0157Help
Entry
WIGMOR_0157       CDS       T01747                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
wgl  Wigglesworthia glossinidia morsitans
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:wgl00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
170558..172204
Genome map
AA seq 548 aa AA seqDB search
MCSIFGILGIKGNYQELRKKAIYCSHLMSHRGPDENGIYTDKNVILLHERLSIVDIKNGH
QPITNSNKTNILIMNGEIYNYEKIKKKLCNHYQFHSHSDCEVILALYDKFGENFLDLLNG
MFAFILYDTKKKCYLIGRDHIGMVPLYIGYDIKKNLYISSEMKALIPVCKTVQEFPPRSY
LWSPDGIIRQYYYRKWFQYENIKDKPVNYEKIIFSLKKSVNMHLNSDVPYAVLLSGGLDS
AIIASITKKLIMLKNGKLKRKRLQSFSIGLLNAPDLIASRKLSRILNTKHHEIIFTEQNG
LDVIRHVIYHVETYDITTIRASIPMYLMSRKIKSCGIKMVLSGEGADEIFGGYLYFHYAP
SAKDFHEELVRKLKLLHMYDCARANKSMLAWGVEIRFPFLEKNFLDLIMNIHPKHKMCPN
KQVEKYILRKAFFEYLPKSILWRQKEQFSDGVGYSWINSLQKLSENEISDKKFENARVRF
PYNTPYSKEGYLYREIFEELFPISNATKCIPYGASIACSSSIASKWRQLEHMIPDPSGRT
LDIHTSKL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctatatttggaattttaggaattaaaggaaattatcaagaactgagaaaaaaa
gcaatatattgctcacatttaatgtcgcatcgtggtccggatgaaaatggtatttataca
gataaaaacgtaattttactacatgaacgcttatctattgttgatataaaaaacggacat
cagccaatcactaattcaaataaaacaaacatattaataatgaatggagaaatttataat
tacgaaaaaattaaaaaaaaattatgtaatcattatcaatttcattcacattcagattgt
gaagtcatattagcattgtatgataagttcggagaaaattttttagatttattaaatggt
atgttcgcttttatcttatatgatacaaaaaaaaagtgttatttaataggtagagatcat
attggaatggttcctttgtatattggatatgatataaaaaaaaatttatatatatcttca
gaaatgaaagcacttattccagtatgcaaaactgtgcaagagtttcctcctaggagttat
ttatggagcccagatggtattatacgtcaatattattacagaaaatggtttcaatatgaa
aacataaaagataaacctgtaaactatgaaaaaattatattttcattaaaaaaatcagta
aatatgcatttaaattccgacgtaccatatgcagtattattatcaggaggtcttgattct
gcaataatagcatctataacaaaaaaattaataatgctaaaaaatggaaaattaaaaaga
aagcgattacaatcattttctattggattgttaaatgctccagatttaattgcatcgaga
aaattatctagaatattaaatacaaaacatcatgaaataatatttacagaacaaaatgga
ttagatgtaatacgtcatgtaatttaccacgtagaaacatatgatattactacaattcgt
gcttcaattccaatgtacttaatgtctagaaaaattaaatcttgcggtattaagatggtg
ctttccggagaaggtgcagatgaaatttttggaggatatctatattttcattatgcacct
agcgcaaaagattttcatgaagagttagtaagaaaattaaaacttttgcacatgtacgat
tgtgcacgtgcaaataaatctatgttagcttggggagtagagatcagatttccgttttta
gagaaaaattttttagatttaattatgaatattcatccaaaacataaaatgtgccctaat
aaacaagttgaaaaatacatcttaagaaaagctttttttgaatatcttcccaaatccatc
ttatggagacaaaaagaacagttttcagatggagtaggttattcttggattaatagttta
caaaagttatctgaaaatgaaattagcgataaaaaatttgaaaatgcccgtgtacgattt
ccatataatactccatattctaaagaaggttatttatatagagaaatttttgaagaattg
tttccaatatctaatgcaacaaaatgtataccttatggtgcatcgattgcatgttcatca
tcaattgcttcaaaatggcgtcaactagaacatatgatcccggacccttccggaagaaca
ttagatatacatacatctaaattgtaa

DBGET integrated database retrieval system