KEGG   Wigglesworthia glossinidia morsitans (Glossina morsitans): WIGMOR_0340Help
Entry
WIGMOR_0340       CDS       T01747                                 

Gene name
sdhD
Definition
cytochrome b556-binding succinate dehydrogenase membrane subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
wgl  Wigglesworthia glossinidia morsitans (Glossina morsitans)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:wgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WIGMOR_0340 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WIGMOR_0340 (sdhD)
   00650 Butanoate metabolism
    WIGMOR_0340 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    WIGMOR_0340 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
350354..350695
Genome map
AA seq 113 aa AA seqDB search
MVKKTSAFGLPGIYEWLLLRISGLLIFLYILCIIVFIICNTPINYVKWHCFFDKKTIKIF
TILVFLSVAIHGWIGMWQVVTDYVKPKFMRTTVQLIICAILLFYLIYGIKIIM
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaaaacgtctgcattcggattacctgggatttatgaatggctattattacgt
atttccggattgttaatatttttatatatactgtgtattatcgtatttattatatgcaat
acacctataaactatgtaaaatggcattgtttttttgataaaaaaacaataaaaatattt
acaatattagtatttttatcagtcgctatacacggatggatcggaatgtggcaagtagtt
acggactatgttaaacctaaattcatgcgcacaacagtacagttaataatatgcgccatt
ttgctattttatttaatatatggtattaaaattataatgtaa

DBGET integrated database retrieval system