KEGG   Wigglesworthia glossinidia morsitans (Glossina morsitans): WIGMOR_0344Help
Entry
WIGMOR_0344       CDS       T01747                                 

Gene name
sucB
Definition
dihydrolipoyltranssuccinase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
wgl  Wigglesworthia glossinidia morsitans (Glossina morsitans)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:wgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WIGMOR_0344 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WIGMOR_0344 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    WIGMOR_0344 (sucB)
Enzymes [BR:wgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     WIGMOR_0344 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
356075..357310
Genome map
AA seq 411 aa AA seqDB search
MKIIDILVPDLPESVTDATVSNWKKKLGDFVETGEILVELETDKVVLEVPSPNSGRLVQI
YHKNSELVSSRQKLASIDITKKNQVLIQEKNTLEEKKHVSKEKKLCENLSEKKSDIFFSP
SIRRLIAKQKNFSADIVQNYSISSNIKNYANQLELSRQLNLIKTENSVNNTHKLDAINIC
QEKRVKMTRLRKCISDRLLYVNNNTASLTTFNEVNMQSIINLREKYRDIFEQTHKIRLGY
MSFFVSAVIKGLKDFPEINANIDGEDIVYHNYFNINIAVSTPKGLVTPVLKNADKMSIIE
IEKKIKDFAIRGKNNKLNIHDLEGGSFTITNGGIFGSMLSTPIINPPQSAILGIHAIKDR
ATVIDKKVVITPMTYLALSYDHRLIDGKEAASFLVTVKNMLEDPIRIFLNI
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatagatatattagttcctgatcttccagagtcagtaacagacgctactgta
tcaaattggaaaaaaaaattaggggattttgtagaaacaggagaaattttagtagaacta
gaaactgataaagttgtattagaagtgccatctccaaattcaggaagactagtacagatc
tatcataaaaattctgaattagtttcttcgcgtcaaaaattagctagtatagatattact
aaaaaaaatcaagttttaatacaagaaaaaaatacacttgaagaaaaaaaacacgtaagt
aaagaaaaaaaattatgtgaaaatttatcagaaaaaaaaagcgacatatttttttcacca
tcaatacgtagattaattgcaaaacaaaaaaatttttcagcagatattgttcaaaattat
tctatatcatcaaatattaaaaattatgctaatcagctcgaactatcacgtcagctaaat
ttaattaaaacggaaaattctgtaaacaacactcacaaacttgatgcaataaatatttgt
caagaaaaaagagtcaaaatgacgcgattaagaaaatgcatatcagatagattgttgtat
gtaaataacaatacagcatctttgacaacttttaatgaagttaatatgcaatctataata
aatttaagagaaaaatatcgagatatatttgaacaaactcataaaattcgtttaggatat
atgtcattttttgtttctgccgtaataaaaggactcaaagattttccagaaattaatgca
aatatagacggggaagatattgtatatcacaattattttaatattaatatagctgtttct
actccaaaagggttagtaactcctgtattaaaaaatgcagataaaatgagcattattgaa
atagaaaagaaaattaaagattttgccattcgaggtaaaaataataagttaaatattcat
gatttagaaggaggcagttttaccattactaatggagggatatttggttctatgttatcg
actccaattatcaatccaccacaaagtgcaattttaggaatacatgcaataaaagataga
gctacagtaatagataaaaaagttgttatcacacccatgacatatttagctttatcttac
gatcatagattaattgatggtaaagaagctgctagttttttagttactgtcaaaaatatg
ttagaagatcctattaggatttttttaaatatttga

DBGET integrated database retrieval system