KEGG   Wigglesworthia glossinidia morsitans (Glossina morsitans): WIGMOR_0344Help
Entry
WIGMOR_0344       CDS       T01747                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyltranssuccinase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
wgl  Wigglesworthia glossinidia morsitans (Glossina morsitans)
Pathway
wgl00020  Citrate cycle (TCA cycle)
wgl00310  Lysine degradation
wgl01100  Metabolic pathways
wgl01110  Biosynthesis of secondary metabolites
wgl01120  Microbial metabolism in diverse environments
wgl01130  Biosynthesis of antibiotics
wgl01200  Carbon metabolism
Module
wgl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:wgl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WIGMOR_0344 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    WIGMOR_0344 (sucB)
Enzymes [BR:wgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     WIGMOR_0344 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 PLDc_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: AFA41179
UniProt: H6Q5Y3
Position
356075..357310
Genome map
AA seq 411 aa AA seqDB search
MKIIDILVPDLPESVTDATVSNWKKKLGDFVETGEILVELETDKVVLEVPSPNSGRLVQI
YHKNSELVSSRQKLASIDITKKNQVLIQEKNTLEEKKHVSKEKKLCENLSEKKSDIFFSP
SIRRLIAKQKNFSADIVQNYSISSNIKNYANQLELSRQLNLIKTENSVNNTHKLDAINIC
QEKRVKMTRLRKCISDRLLYVNNNTASLTTFNEVNMQSIINLREKYRDIFEQTHKIRLGY
MSFFVSAVIKGLKDFPEINANIDGEDIVYHNYFNINIAVSTPKGLVTPVLKNADKMSIIE
IEKKIKDFAIRGKNNKLNIHDLEGGSFTITNGGIFGSMLSTPIINPPQSAILGIHAIKDR
ATVIDKKVVITPMTYLALSYDHRLIDGKEAASFLVTVKNMLEDPIRIFLNI
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatagatatattagttcctgatcttccagagtcagtaacagacgctactgta
tcaaattggaaaaaaaaattaggggattttgtagaaacaggagaaattttagtagaacta
gaaactgataaagttgtattagaagtgccatctccaaattcaggaagactagtacagatc
tatcataaaaattctgaattagtttcttcgcgtcaaaaattagctagtatagatattact
aaaaaaaatcaagttttaatacaagaaaaaaatacacttgaagaaaaaaaacacgtaagt
aaagaaaaaaaattatgtgaaaatttatcagaaaaaaaaagcgacatatttttttcacca
tcaatacgtagattaattgcaaaacaaaaaaatttttcagcagatattgttcaaaattat
tctatatcatcaaatattaaaaattatgctaatcagctcgaactatcacgtcagctaaat
ttaattaaaacggaaaattctgtaaacaacactcacaaacttgatgcaataaatatttgt
caagaaaaaagagtcaaaatgacgcgattaagaaaatgcatatcagatagattgttgtat
gtaaataacaatacagcatctttgacaacttttaatgaagttaatatgcaatctataata
aatttaagagaaaaatatcgagatatatttgaacaaactcataaaattcgtttaggatat
atgtcattttttgtttctgccgtaataaaaggactcaaagattttccagaaattaatgca
aatatagacggggaagatattgtatatcacaattattttaatattaatatagctgtttct
actccaaaagggttagtaactcctgtattaaaaaatgcagataaaatgagcattattgaa
atagaaaagaaaattaaagattttgccattcgaggtaaaaataataagttaaatattcat
gatttagaaggaggcagttttaccattactaatggagggatatttggttctatgttatcg
actccaattatcaatccaccacaaagtgcaattttaggaatacatgcaataaaagataga
gctacagtaatagataaaaaagttgttatcacacccatgacatatttagctttatcttac
gatcatagattaattgatggtaaagaagctgctagttttttagttactgtcaaaaatatg
ttagaagatcctattaggatttttttaaatatttga

DBGET integrated database retrieval system