KEGG   Wigglesworthia glossinidia morsitans (Glossina morsitans): WIGMOR_0345Help
Entry
WIGMOR_0345       CDS       T01747                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
wgl  Wigglesworthia glossinidia morsitans (Glossina morsitans)
Pathway
wgl00020  Citrate cycle (TCA cycle)
wgl00640  Propanoate metabolism
wgl01100  Metabolic pathways
wgl01110  Biosynthesis of secondary metabolites
wgl01120  Microbial metabolism in diverse environments
wgl01130  Biosynthesis of antibiotics
wgl01200  Carbon metabolism
Module
wgl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:wgl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WIGMOR_0345 (sucC)
   00640 Propanoate metabolism
    WIGMOR_0345 (sucC)
   00660 C5-Branched dibasic acid metabolism
    WIGMOR_0345 (sucC)
Enzymes [BR:wgl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     WIGMOR_0345 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Smg8_Smg9
Motif
Other DBs
NCBI-ProteinID: AFA41180
UniProt: H6Q5Y4
Position
357374..358561
Genome map
AA seq 395 aa AA seqDB search
MNLHEYQAKELFSQYKIPIPNGYKCTKYSEIEKAVVKLNPGPWVVKCQIHAGGRGKSGGV
QTLNSIDEIHKFAKKWIGKRLVTYQTDNIGQTVNSILIERKTYIKKELYLSLVLNRIQSN
ISILASFTGGINIENDIKTNKKIIFKENFDVCCGFQLFKARNLAFQLKLFGKQINQFVTI
CENLTYLFIEKDLTLAEINPIAINQNDDLLCLDGKLNIDENALYRQVHLKKIHDNSQLDS
REVYAEKWGLNYIPLQGNIGCMVNGAGLAMGTMDLIKLHGGNPANFLDVGGDATVEKVDQ
AFRIIILDSHVKSILINIFGGIVKCDLIADGIIQAISNLQVNIPVIVRLEGNNSKLGAKK
LINSNLNIITANSLDDAVKKAIENIGRKTYVDSNR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacacgaatatcaagcaaaagaactgttttctcaatataaaattccaattcca
aatggatataaatgtactaaatatagtgaaatcgagaaagctgtcgtaaaattaaatcct
ggaccgtgggtagtaaaatgtcaaatacatgcaggcggtagaggtaaatccggaggagta
caaacattaaattctattgatgaaattcataaatttgcgaagaaatggataggaaaacgt
ttagtaacctaccaaacagataatataggacaaacagtaaattcaatattaattgaaaga
aaaacatatattaaaaaagaattatacttaagcttagtgctaaacagaatacaatctaat
atatccatacttgcttcttttacaggcggtataaatattgaaaatgatattaaaacaaat
aaaaagataatctttaaagaaaattttgatgtttgttgcggatttcagctgtttaaagca
agaaatttagcatttcaattaaaactatttggaaaacaaataaatcaatttgtgacaatt
tgtgaaaatttaacatatttatttatcgagaaagatcttactcttgcagaaattaaccca
attgctattaatcaaaatgatgatttattatgtttagacggaaaattaaatatagatgaa
aatgctttatatagacaagtgcatttaaaaaagatacatgataatagtcaattagattct
agagaagtatatgctgaaaagtggggattaaattatattccgttacaaggaaacataggc
tgtatggttaatggtgcaggtttagcaatgggcactatggatttaattaaattgcacggc
ggtaatccagcaaattttttagatgttggaggtgatgcaacagtagaaaaagtagatcaa
gcttttagaattattattcttgacagccatgtaaaatctattttaattaatatttttgga
ggaattgttaagtgcgatcttattgctgatggtatcatacaagcaatttctaacttacaa
gttaatataccagttattgtacgtttagaaggtaataattctaaattaggagcaaaaaag
ttaataaatagtaatttaaatattattacagcaaattcactagatgatgcggttaaaaaa
gcaattgaaaatattgggagaaagacttatgtcgattctaatcgataa

DBGET integrated database retrieval system