KEGG   Wigglesworthia glossinidia morsitans (Glossina morsitans): WIGMOR_0345Help
Entry
WIGMOR_0345       CDS       T01747                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
wgl  Wigglesworthia glossinidia morsitans (Glossina morsitans)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:wgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WIGMOR_0345 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WIGMOR_0345 (sucC)
   00640 Propanoate metabolism
    WIGMOR_0345 (sucC)
   00660 C5-Branched dibasic acid metabolism
    WIGMOR_0345 (sucC)
Enzymes [BR:wgl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     WIGMOR_0345 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
357374..358561
Genome map
AA seq 395 aa AA seqDB search
MNLHEYQAKELFSQYKIPIPNGYKCTKYSEIEKAVVKLNPGPWVVKCQIHAGGRGKSGGV
QTLNSIDEIHKFAKKWIGKRLVTYQTDNIGQTVNSILIERKTYIKKELYLSLVLNRIQSN
ISILASFTGGINIENDIKTNKKIIFKENFDVCCGFQLFKARNLAFQLKLFGKQINQFVTI
CENLTYLFIEKDLTLAEINPIAINQNDDLLCLDGKLNIDENALYRQVHLKKIHDNSQLDS
REVYAEKWGLNYIPLQGNIGCMVNGAGLAMGTMDLIKLHGGNPANFLDVGGDATVEKVDQ
AFRIIILDSHVKSILINIFGGIVKCDLIADGIIQAISNLQVNIPVIVRLEGNNSKLGAKK
LINSNLNIITANSLDDAVKKAIENIGRKTYVDSNR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacacgaatatcaagcaaaagaactgttttctcaatataaaattccaattcca
aatggatataaatgtactaaatatagtgaaatcgagaaagctgtcgtaaaattaaatcct
ggaccgtgggtagtaaaatgtcaaatacatgcaggcggtagaggtaaatccggaggagta
caaacattaaattctattgatgaaattcataaatttgcgaagaaatggataggaaaacgt
ttagtaacctaccaaacagataatataggacaaacagtaaattcaatattaattgaaaga
aaaacatatattaaaaaagaattatacttaagcttagtgctaaacagaatacaatctaat
atatccatacttgcttcttttacaggcggtataaatattgaaaatgatattaaaacaaat
aaaaagataatctttaaagaaaattttgatgtttgttgcggatttcagctgtttaaagca
agaaatttagcatttcaattaaaactatttggaaaacaaataaatcaatttgtgacaatt
tgtgaaaatttaacatatttatttatcgagaaagatcttactcttgcagaaattaaccca
attgctattaatcaaaatgatgatttattatgtttagacggaaaattaaatatagatgaa
aatgctttatatagacaagtgcatttaaaaaagatacatgataatagtcaattagattct
agagaagtatatgctgaaaagtggggattaaattatattccgttacaaggaaacataggc
tgtatggttaatggtgcaggtttagcaatgggcactatggatttaattaaattgcacggc
ggtaatccagcaaattttttagatgttggaggtgatgcaacagtagaaaaagtagatcaa
gcttttagaattattattcttgacagccatgtaaaatctattttaattaatatttttgga
ggaattgttaagtgcgatcttattgctgatggtatcatacaagcaatttctaacttacaa
gttaatataccagttattgtacgtttagaaggtaataattctaaattaggagcaaaaaag
ttaataaatagtaatttaaatattattacagcaaattcactagatgatgcggttaaaaaa
gcaattgaaaatattgggagaaagacttatgtcgattctaatcgataa

DBGET integrated database retrieval system