KEGG   Wigglesworthia glossinidia morsitans (Glossina morsitans): WIGMOR_0397Help
Entry
WIGMOR_0397       CDS       T01747                                 

Gene name
galU
Definition
glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
wgl  Wigglesworthia glossinidia morsitans (Glossina morsitans)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:wgl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    WIGMOR_0397 (galU)
   00052 Galactose metabolism
    WIGMOR_0397 (galU)
   00500 Starch and sucrose metabolism
    WIGMOR_0397 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    WIGMOR_0397 (galU)
Enzymes [BR:wgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     WIGMOR_0397 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
409317..410207
Genome map
AA seq 296 aa AA seqDB search
MTTKKINTVIIPAAGLGTRMLPITATIPKEMLPIVDIPLIQYSINECILSGLYNIILITK
SCKYLIESYLDCNINIYKFLEKKRQSDIFSKIKLVYPSYVTITYIHQKNINGLGNAILSA
FPIIKNQPFAVVLPDIIINEYTSNLKKDNLSAMLKRFQNTGRSQILVKKVRNFQNYGIVY
CEKKSMHFNKHAKIIKVIEKPNINNNFSNLSIVGRYVFSKNIWKKLKKIKPGKNEEFQLT
DAIDLLIQDEIVEAYPIIGLSHDCGNKLGYMQAFVQYGLYHKKFGKIFKKWIKSII
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaaaaaaataaatactgttattattccagcagctggattaggtacacgcatg
ctgcctattactgcaacaattccaaaagaaatgttgccaatcgtcgatattccattaatt
caatattctattaatgaatgtattttatctggattatacaatattatattaatcacaaaa
tcttgcaaatatttaattgaaagttatcttgattgtaatattaacatatataaattttta
gaaaaaaaaagacaatctgatatattttctaaaataaaattagtttatccatcatacgta
acaatcacatatattcatcaaaaaaatataaacggattaggtaatgcgattttgtctgca
tttcctataattaaaaatcaaccatttgctgttgtactacccgatattattattaatgaa
tacacttcaaatttaaaaaaagataatttatctgccatgctaaaacgttttcaaaataca
ggaagaagtcaaatattagtgaaaaaagtacgtaattttcaaaattatggcatagtatat
tgtgaaaaaaaaagtatgcattttaataaacacgcaaaaattattaaagtcatcgaaaaa
cctaatataaataacaacttttcaaatttgtctattgtaggacgatatgtattttctaaa
aatatttggaaaaaattaaaaaaaataaaaccaggaaaaaatgaagaatttcaattaaca
gacgctatcgacttgttaatacaagatgaaattgtagaggcatatcctataataggatta
agtcatgattgtggaaataaattaggatatatgcaagcttttgtgcaatatggtttatat
cataaaaaatttggaaaaatttttaaaaaatggataaagtctataatatag

DBGET integrated database retrieval system