KEGG   Wigglesworthia glossinidia morsitans (Glossina morsitans): WIGMOR_0397Help
Entry
WIGMOR_0397       CDS       T01747                                 

Gene name
galU
Definition
(GenBank) glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
wgl  Wigglesworthia glossinidia morsitans (Glossina morsitans)
Pathway
wgl00040  Pentose and glucuronate interconversions
wgl00052  Galactose metabolism
wgl00500  Starch and sucrose metabolism
wgl00520  Amino sugar and nucleotide sugar metabolism
wgl01100  Metabolic pathways
wgl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:wgl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    WIGMOR_0397 (galU)
   00052 Galactose metabolism
    WIGMOR_0397 (galU)
   00500 Starch and sucrose metabolism
    WIGMOR_0397 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    WIGMOR_0397 (galU)
Enzymes [BR:wgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     WIGMOR_0397 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AFA41229
UniProt: H6Q4U6
Position
409317..410207
Genome map
AA seq 296 aa AA seqDB search
MTTKKINTVIIPAAGLGTRMLPITATIPKEMLPIVDIPLIQYSINECILSGLYNIILITK
SCKYLIESYLDCNINIYKFLEKKRQSDIFSKIKLVYPSYVTITYIHQKNINGLGNAILSA
FPIIKNQPFAVVLPDIIINEYTSNLKKDNLSAMLKRFQNTGRSQILVKKVRNFQNYGIVY
CEKKSMHFNKHAKIIKVIEKPNINNNFSNLSIVGRYVFSKNIWKKLKKIKPGKNEEFQLT
DAIDLLIQDEIVEAYPIIGLSHDCGNKLGYMQAFVQYGLYHKKFGKIFKKWIKSII
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaaaaaaataaatactgttattattccagcagctggattaggtacacgcatg
ctgcctattactgcaacaattccaaaagaaatgttgccaatcgtcgatattccattaatt
caatattctattaatgaatgtattttatctggattatacaatattatattaatcacaaaa
tcttgcaaatatttaattgaaagttatcttgattgtaatattaacatatataaattttta
gaaaaaaaaagacaatctgatatattttctaaaataaaattagtttatccatcatacgta
acaatcacatatattcatcaaaaaaatataaacggattaggtaatgcgattttgtctgca
tttcctataattaaaaatcaaccatttgctgttgtactacccgatattattattaatgaa
tacacttcaaatttaaaaaaagataatttatctgccatgctaaaacgttttcaaaataca
ggaagaagtcaaatattagtgaaaaaagtacgtaattttcaaaattatggcatagtatat
tgtgaaaaaaaaagtatgcattttaataaacacgcaaaaattattaaagtcatcgaaaaa
cctaatataaataacaacttttcaaatttgtctattgtaggacgatatgtattttctaaa
aatatttggaaaaaattaaaaaaaataaaaccaggaaaaaatgaagaatttcaattaaca
gacgctatcgacttgttaatacaagatgaaattgtagaggcatatcctataataggatta
agtcatgattgtggaaataaattaggatatatgcaagcttttgtgcaatatggtttatat
cataaaaaatttggaaaaatttttaaaaaatggataaagtctataatatag

DBGET integrated database retrieval system