KEGG   Wigglesworthia glossinidia morsitans (Glossina morsitans): WIGMOR_0448Help
Entry
WIGMOR_0448       CDS       T01747                                 

Gene name
aceF
Definition
pyruvate dehydrogenase, dihydrolipoyltransacetylase component E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
wgl  Wigglesworthia glossinidia morsitans (Glossina morsitans)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:wgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WIGMOR_0448 (aceF)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WIGMOR_0448 (aceF)
   00020 Citrate cycle (TCA cycle)
    WIGMOR_0448 (aceF)
   00620 Pyruvate metabolism
    WIGMOR_0448 (aceF)
Enzymes [BR:wgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     WIGMOR_0448 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
460242..461735
Genome map
AA seq 497 aa AA seqDB search
MNTVVKIPDIGIEDAEVTEILVKIEDKIKKEQALITVEGDKASMQIPSPISGILKKIMVK
IGDKVSTNQEIMFFEKTDKNDKFIAKKMLKKVEKKLLDSKHEEFKKIYASELGILNRAEI
IRVSIHEENNIKINSPILIIQDCKGTRKILSTISGIVKNVQIKAGDHVDPDTLLYDIYVS
KIFEKKPKNLLKTIIQNNQIYASPLIRRIALKYNINLSHIHGSGRKGRILPTDLEKYINI
YENNQLSQNTKNVQSFSEDSQYEVYGKIEIQELTKIKKVSGKNLSKNWKNIPHVTQFDQA
DIHELEIFRKNQNIILQKKNKIKITILSFVIKAVIATLKEYPQFNSSLSQDQKKIFLKKY
FNIGIAVNTEQGLMVPIIFNADSKGILEISQEISNIAKKARSGILSNKDMKGGCFTISNL
GGIGGKEFTPIINAPEVAILGISQASIQAIWNGDTFVPKLMLPLSLSYDHRVIDGVEGAK
FINFFKNLISDIRLLIL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaataccgtggttaaaattccagatatcgggatagaagatgcagaagtaacagaaata
ttagtaaaaatagaagataaaattaagaaagaacaagcactgattacagttgaaggagat
aaagcatctatgcaaatcccttctcctatctcagggattttaaaaaaaattatggtaaaa
attggagataaagtatctactaatcaagaaattatgttttttgaaaaaactgataaaaat
gataaatttattgccaaaaaaatgctaaaaaaagttgaaaaaaaattacttgattctaaa
catgaagagtttaaaaaaatatatgctagtgaattaggaatattgaatcgtgccgaaatt
atacgtgtatcaattcatgaagaaaataatataaaaattaattctcctattttaattatt
caagattgcaaaggaactagaaaaattttatcaacaatttctggaatagtaaaaaatgtt
caaattaaagctggtgatcacgttgaccctgacacattactttatgatatttatgtttct
aaaatttttgaaaaaaaaccaaaaaatttgttaaaaaccataattcaaaataatcaaata
tatgctagtccattaataagacgcattgcattaaaatataatattaatttatctcatata
cacggtagcggtcgtaaaggaagaattttacctacagatcttgagaaatatattaatatt
tatgaaaataatcaactgagtcaaaatacgaaaaatgttcaaagtttttcagaagattca
cagtacgaagtatatggaaaaattgaaattcaagaattgacgaaaataaaaaaagtttct
ggaaaaaatttatctaaaaattggaaaaatatcccacatgtaacacaatttgatcaggca
gatattcatgaattagaaatttttagaaaaaatcaaaatattatattacaaaaaaaaaat
aaaataaaaattacaattttatcttttgttattaaagctgttattgcaactttgaaagag
tatcctcaatttaatagttctttatctcaagatcaaaaaaaaatatttttgaaaaaatat
tttaatatcggtattgctgtaaatacagaacaaggattaatggtacccataatttttaat
gcggattcaaaagggattctagaaatctctcaagagatatcaaatattgcaaaaaaagct
agatcaggaatattgtccaataaagatatgaaaggtggatgttttacaatatctaatcta
ggaggtattggaggaaaagaatttactccaattattaacgctccagaagtagcaatttta
ggaatttctcaggcgagtatacaagctatttggaacggcgatacttttgtgcccaaatta
atgttgccattatctttatcttatgatcatcgcgtcatcgatggcgtagaaggtgctaaa
tttattaatttttttaaaaaccttatatctgatattagattactaatattgtga

DBGET integrated database retrieval system