KEGG   Wigglesworthia glossinidia morsitans (Glossina morsitans): WIGMOR_0453Help
Entry
WIGMOR_0453       CDS       T01747                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
wgl  Wigglesworthia glossinidia morsitans (Glossina morsitans)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wgl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    WIGMOR_0453 (folE)
Enzymes [BR:wgl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     WIGMOR_0453 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(465961..466626)
Genome map
AA seq 221 aa AA seqDB search
MSKFTKEALQVKHALISQGLENPFFNCFKDIKQKKVLIAKYIQKIMKLLNLNLTNDSLSQ
TPLRIARMYIEEIFSGLNYANFPKITVIKNITKINEMIIIDDIIFHSICEHHFLVFEGKA
TVAYIPEYVLIGLSKINRIVNFFSKRPQIQERLTRQILIALQILLSTKNVAVSIRARHFC
VRARGIKDSESNTKTLAFGGKFRDQLHLRNEFLQITNNSKL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaatttacgaaagaagctttgcaagtgaaacatgcattgatatctcaaggttta
gaaaatcctttttttaattgttttaaagatataaaacaaaaaaaagtattgattgccaaa
tacattcaaaaaattatgaagcttttgaatttaaatttaactaacgatagtttgtcgcaa
acaccattgcgaattgcacgaatgtatatagaagaaattttttctggattgaattatgct
aattttcctaaaataactgttataaaaaatataacaaaaattaacgagatgattattata
gacgatatcatttttcatagtatatgtgagcatcatttcttagtttttgaaggaaaagca
actgttgcttatattcccgaatacgtcttaattggtttatctaaaataaatcgaattgtc
aattttttttctaaacgtcctcaaatacaagaacgacttacacgtcaaattttaattgct
ttgcaaattttactcagtacaaaaaacgtagcagtttcaatacgcgctcgtcatttttgt
gtaagagcgcgaggaattaaagattctgaaagtaacacaaaaacattagcgtttggtggc
aaatttcgtgatcaattgcatttgagaaatgaatttttacaaattactaataatagtaaa
ttataa

DBGET integrated database retrieval system