KEGG   Wigglesworthia glossinidia morsitans (Glossina morsitans): WIGMOR_0496Help
Entry
WIGMOR_0496       CDS       T01747                                 

Gene name
dapE
Definition
N-succinyl-diaminopimelate deacylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
wgl  Wigglesworthia glossinidia morsitans (Glossina morsitans)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:wgl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    WIGMOR_0496 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    WIGMOR_0496 (dapE)
Enzymes [BR:wgl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     WIGMOR_0496 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(508722..509870)
Genome map
AA seq 382 aa AA seqDB search
MSYHDPIVNLTHNLIKCRSLTPNEAGCNKIIINYLLNIGFKIEIMQFGTTQNIWAYRGSG
YTLLFLGHTDVVHVGNLKYWKYPPFEPTLNNGFLYGRGASDMKGALSAMLVATKKFFSVH
KNFNQGRLAFLISSDEEGSGQNGTKKVVEILMQRKEKIDCCLIGEPTGERSVGDIIKNGR
RGSLDIYITIYGKQEHIAYANFRKNPIYLINLIISRLTQISWDNNKCNLPKTSMQFLKIL
SDFKSSNNVTPSQVLLKLNFRFNLQSNKVIIQKKIEDILKIFNCTYKIKCNVNSNPFITK
KGSLFQIVKNSVKKYQNIIPSIKNSGGTSDGRFIYKISKQIIELGLLNNTIHQENECVKI
RDLQILCCIYQEILSKIYFDQN
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatcatgatccgattgttaatttaacgcacaatcttataaaatgccgatcttta
actccaaacgaagctggatgtaacaaaattattattaactacctacttaatataggtttt
aaaattgaaattatgcaatttggaaccacccaaaacatttgggcttatcgaggttcagga
tatactttattgttcttaggccatactgatgtggtacatgtcggaaatttaaaatattgg
aaatatcctccattcgaaccaactctgaataatggatttttatatggtagaggcgcttca
gatatgaaaggcgcattatctgcaatgttagttgctacaaaaaaattttttagtgttcat
aaaaattttaatcaaggaagattagcatttttaatttcttctgatgaagaaggatccggt
caaaatggaactaaaaaagttgttgaaattttaatgcaaagaaaagaaaaaattgattgc
tgtttaattggagaaccaacaggagaaagatcagtcggagatatcattaaaaatggtaga
agaggatcattagatatatatattactatttacggaaaacaagaacatatcgcatatgca
aattttagaaaaaatccaatttatttaatcaatttgataatatcccgattaacacaaata
tcttgggataacaataaatgtaatttaccaaaaactagtatgcaatttttgaaaatctta
agtgattttaaatcatctaacaatgttactccaagtcaagttttattaaaattaaatttt
cgatttaatctacaatcgaataaagttattattcaaaagaaaatcgaagatatattaaaa
atatttaattgtacttataaaataaaatgcaatgtaaatagtaatccttttataacaaaa
aaaggatcattatttcaaatagttaaaaactcagttaaaaaatatcaaaatattattcca
tctataaaaaattcgggtggtacttcagatggaagatttatttataaaattagcaaacaa
attatagaattaggtttattgaataatacaattcatcaagaaaacgaatgcgtaaaaatt
cgagatttacaaattttatgttgtatatatcaagaaattttatcaaaaatatatttcgat
caaaattaa

DBGET integrated database retrieval system