KEGG   Wigglesworthia glossinidia morsitans: WIGMOR_0505Help
Entry
WIGMOR_0505       CDS       T01747                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
wgl  Wigglesworthia glossinidia morsitans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:wgl01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:wgl01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:wgl00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:wgl00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:wgl00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
517571..518338
Genome map
AA seq 255 aa AA seqDB search
MKKIPFILANWKLNGNLLLIKQTLIRLNKERNFLKKLKIAIAPPIIYLSEAQKYIYDNKN
IYLAAQNVDAHISGPFTGEISAYMLQEFGIKYVIIGHAERRQFHYEDYKVITKKFLILKQ
YNLIPVLCIGELYKDYANKEIRNICIKQINPILDVLGIESFKRTIIAYEPIWAIGTGKTP
SPEYIQNAHLCIRSYLSQYDDSIAKNVVLQYGGSVNANNVLKILLQSDVDGILLGKSSIH
LNEFLSILRIVSNFL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattccatttatattggcaaactggaaattaaacgggaatcttttgttaata
aaacaaacattaattagattaaacaaagagagaaattttttaaaaaaattaaaaattgct
attgctcctccaataatatatttaagcgaagcacaaaaatatatttacgataataaaaat
atttatttagccgcacaaaacgttgatgcgcatatttctggaccttttactggagaaatt
tcggcttatatgttgcaagaatttgggataaaatatgtcattataggacatgctgaacgt
agacaatttcactatgaagattataaagtaattactaaaaaatttttgattcttaaacaa
tataatttaataccagtattatgtatcggagaattgtacaaagattatgccaacaaagaa
ataagaaatatttgtatcaaacaaattaatcctattttagacgttttagggattgaaagc
tttaaaagaacaattatcgcgtatgaaccaatttgggctataggtaccggaaaaacacca
tccccagaatatatacaaaatgcacatttatgcattcgtagttatttatctcaatacgat
gacagtattgctaaaaatgttgttttgcaatatggtggttcagtaaatgcgaacaatgtt
ttaaaaatattattacagtctgatgtagacggcattttattaggtaaatcgtctattcat
ttaaatgaatttttatctattttacgtattgtaagtaattttttataa

DBGET integrated database retrieval system