KEGG   Wigglesworthia glossinidia morsitans (Glossina morsitans): WIGMOR_0505Help
Entry
WIGMOR_0505       CDS       T01747                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
wgl  Wigglesworthia glossinidia morsitans (Glossina morsitans)
Pathway
wgl00010  Glycolysis / Gluconeogenesis
wgl00051  Fructose and mannose metabolism
wgl00562  Inositol phosphate metabolism
wgl01100  Metabolic pathways
wgl01110  Biosynthesis of secondary metabolites
wgl01120  Microbial metabolism in diverse environments
wgl01130  Biosynthesis of antibiotics
wgl01200  Carbon metabolism
wgl01230  Biosynthesis of amino acids
Module
wgl_M00002  Glycolysis, core module involving three-carbon compounds
wgl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:wgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WIGMOR_0505 (tpiA)
   00051 Fructose and mannose metabolism
    WIGMOR_0505 (tpiA)
   00562 Inositol phosphate metabolism
    WIGMOR_0505 (tpiA)
Enzymes [BR:wgl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     WIGMOR_0505 (tpiA)
Exosome [BR:wgl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   WIGMOR_0505 (tpiA)
  Exosomal proteins of bladder cancer cells
   WIGMOR_0505 (tpiA)
  Exosomal proteins of melanoma cells
   WIGMOR_0505 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFA41326
UniProt: H6Q543
Position
517571..518338
Genome map
AA seq 255 aa AA seqDB search
MKKIPFILANWKLNGNLLLIKQTLIRLNKERNFLKKLKIAIAPPIIYLSEAQKYIYDNKN
IYLAAQNVDAHISGPFTGEISAYMLQEFGIKYVIIGHAERRQFHYEDYKVITKKFLILKQ
YNLIPVLCIGELYKDYANKEIRNICIKQINPILDVLGIESFKRTIIAYEPIWAIGTGKTP
SPEYIQNAHLCIRSYLSQYDDSIAKNVVLQYGGSVNANNVLKILLQSDVDGILLGKSSIH
LNEFLSILRIVSNFL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattccatttatattggcaaactggaaattaaacgggaatcttttgttaata
aaacaaacattaattagattaaacaaagagagaaattttttaaaaaaattaaaaattgct
attgctcctccaataatatatttaagcgaagcacaaaaatatatttacgataataaaaat
atttatttagccgcacaaaacgttgatgcgcatatttctggaccttttactggagaaatt
tcggcttatatgttgcaagaatttgggataaaatatgtcattataggacatgctgaacgt
agacaatttcactatgaagattataaagtaattactaaaaaatttttgattcttaaacaa
tataatttaataccagtattatgtatcggagaattgtacaaagattatgccaacaaagaa
ataagaaatatttgtatcaaacaaattaatcctattttagacgttttagggattgaaagc
tttaaaagaacaattatcgcgtatgaaccaatttgggctataggtaccggaaaaacacca
tccccagaatatatacaaaatgcacatttatgcattcgtagttatttatctcaatacgat
gacagtattgctaaaaatgttgttttgcaatatggtggttcagtaaatgcgaacaatgtt
ttaaaaatattattacagtctgatgtagacggcattttattaggtaaatcgtctattcat
ttaaatgaatttttatctattttacgtattgtaagtaattttttataa

DBGET integrated database retrieval system