KEGG   Wigglesworthia glossinidia morsitans (Glossina morsitans): WIGMOR_0505Help
Entry
WIGMOR_0505       CDS       T01747                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
wgl  Wigglesworthia glossinidia morsitans (Glossina morsitans)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:wgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WIGMOR_0505 (tpiA)
   01230 Biosynthesis of amino acids
    WIGMOR_0505 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WIGMOR_0505 (tpiA)
   00051 Fructose and mannose metabolism
    WIGMOR_0505 (tpiA)
   00562 Inositol phosphate metabolism
    WIGMOR_0505 (tpiA)
Enzymes [BR:wgl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     WIGMOR_0505 (tpiA)
Exosome [BR:wgl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   WIGMOR_0505 (tpiA)
  Exosomal proteins of bladder cancer cells
   WIGMOR_0505 (tpiA)
  Exosomal proteins of melanoma cells
   WIGMOR_0505 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
517571..518338
Genome map
AA seq 255 aa AA seqDB search
MKKIPFILANWKLNGNLLLIKQTLIRLNKERNFLKKLKIAIAPPIIYLSEAQKYIYDNKN
IYLAAQNVDAHISGPFTGEISAYMLQEFGIKYVIIGHAERRQFHYEDYKVITKKFLILKQ
YNLIPVLCIGELYKDYANKEIRNICIKQINPILDVLGIESFKRTIIAYEPIWAIGTGKTP
SPEYIQNAHLCIRSYLSQYDDSIAKNVVLQYGGSVNANNVLKILLQSDVDGILLGKSSIH
LNEFLSILRIVSNFL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattccatttatattggcaaactggaaattaaacgggaatcttttgttaata
aaacaaacattaattagattaaacaaagagagaaattttttaaaaaaattaaaaattgct
attgctcctccaataatatatttaagcgaagcacaaaaatatatttacgataataaaaat
atttatttagccgcacaaaacgttgatgcgcatatttctggaccttttactggagaaatt
tcggcttatatgttgcaagaatttgggataaaatatgtcattataggacatgctgaacgt
agacaatttcactatgaagattataaagtaattactaaaaaatttttgattcttaaacaa
tataatttaataccagtattatgtatcggagaattgtacaaagattatgccaacaaagaa
ataagaaatatttgtatcaaacaaattaatcctattttagacgttttagggattgaaagc
tttaaaagaacaattatcgcgtatgaaccaatttgggctataggtaccggaaaaacacca
tccccagaatatatacaaaatgcacatttatgcattcgtagttatttatctcaatacgat
gacagtattgctaaaaatgttgttttgcaatatggtggttcagtaaatgcgaacaatgtt
ttaaaaatattattacagtctgatgtagacggcattttattaggtaaatcgtctattcat
ttaaatgaatttttatctattttacgtattgtaagtaattttttataa

DBGET integrated database retrieval system