KEGG   Wigglesworthia glossinidia morsitans: WIGMOR_0554Help
Entry
WIGMOR_0554       CDS       T01747                                 

Gene name
folP
Definition
7,8-dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
wgl  Wigglesworthia glossinidia morsitans
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wgl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    WIGMOR_0554 (folP)
Enzymes [BR:wgl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     WIGMOR_0554 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
571236..572078
Genome map
AA seq 280 aa AA seqDB search
MLTKLKNILSKPCIMGILNVTPDSFSDGGQFTCINKAINHVRFMIDSGAKIIDVGGESSR
PGAKRVSELEESERVIPIIEYILKKFNVFVSVNTSHFSIMQECIKLGVHIINDIRSFSEC
NSLHDIIDSDVMLCLMHMKGNPENMQKFPQYKCIKSEIKEFFTKKISFFINQGIKKNRII
IDPGFGFGKNMEHNYHLLANLKIFLEFQVPILVGFSRKVMTDINKKYLPNKRIIGSIVCA
ILACIEGASIIRVHDVQETVDALSIFNAFISEKNLLHGTS
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcttacaaaactaaagaatatattatcaaaaccgtgcatcatgggaattttaaatgtc
acaccggattcgttttctgatggtggacagtttacttgcataaacaaagcgattaatcac
gttcgttttatgatagactcgggtgctaaaattatcgatgttggaggagaatctagtcgt
ccaggagcaaaaagggttagcgaacttgaagaatcagaacgagttattccaataatagaa
tatattttaaaaaaatttaatgtgtttgtttcagtaaatacatcgcatttttctattatg
caagaatgtataaaacttggtgtacatataataaatgatattagatcattttctgaatgc
aattcgttacatgatattattgatagcgatgttatgctgtgcttgatgcacatgaaagga
aatccagaaaatatgcaaaaatttccacagtataaatgtataaaatcagaaataaaagaa
ttttttacaaaaaaaatttctttttttattaatcaaggaataaaaaaaaatcgtataatc
attgaccccggttttggtttcggaaaaaatatggaacataattatcatttattagcaaat
ctaaaaatttttttagaatttcaagttcctatacttgtaggattttcaagaaaagtaatg
acagatataaacaaaaaatatttgccaaataaacgaattatcggaagtattgtatgtgca
attcttgcatgtattgaaggtgcatctattattagagtacacgatgtccaagaaactgtt
gatgcactaagtattttcaatgcatttatttcagaaaaaaatttattgcatggtacatcg
taa

DBGET integrated database retrieval system