KEGG   Wigglesworthia glossinidia morsitans: WIGMOR_0568Help
Entry
WIGMOR_0568       CDS       T01747                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
wgl  Wigglesworthia glossinidia morsitans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:wgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WIGMOR_0568 (gpmA)
   01230 Biosynthesis of amino acids
    WIGMOR_0568 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WIGMOR_0568 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    WIGMOR_0568 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    WIGMOR_0568 (gpmA)
Enzymes [BR:wgl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     WIGMOR_0568 (gpmA)
Exosome [BR:wgl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   WIGMOR_0568 (gpmA)
  Exosomal proteins of melanoma cells
   WIGMOR_0568 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(587846..588544)
Genome map
AA seq 232 aa AA seqDB search
MSIIKLVLMRHGRSIWNDQDRFTGWTDIELSEKGEKEVKYAGEVLRSFGYLFDFAYTSLL
KRAIHSLWILLQEIDQSWIPIEKSWRLNERHYGALQGFSKNEIKTKYGSAQLKEWRRGFL
SIPPKLNTNDIRFPGNDPRYLRLKLSGQLPTTESLKSTIDRIIPYWKKKIFPKLKNKNKL
IIVAHGNSIRAIMKLLDNLDEKQITQLNVPTGVPLIYEFDKNVCPKKHYFLF
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtctataattaaattggttttgatgcgtcatggaagaagtatatggaacgatcaagat
cgttttactggatggacagatattgaattatctgaaaaaggcgaaaaagaagtaaaatat
gcaggagaagtattaagatcttttgggtatttatttgattttgcttatacatctttatta
aaaagagctattcatagtttatggattcttttacaagaaatagatcaatcttggattcca
atagaaaaatcttggagattaaacgaaagacattacggagctttacaaggatttagcaaa
aatgaaattaaaacaaaatatggcagtgcacaattaaaagaatggcgtcgtggattttta
agtatccctccgaaattaaacacaaatgacatacgatttccaggaaatgatccgcgatat
cttcgtttaaaactttctggtcaacttcctactacagaaagcttaaaatctacaattgat
cgtattataccgtattggaaaaaaaaaattttccccaaattaaaaaataagaataaatta
attattgttgcacatggaaattctattcgagcaattatgaaattattagataatcttgac
gaaaaacaaataacccagttaaatgtgcccactggagtaccattaatatacgaatttgat
aaaaatgtatgtcctaaaaagcactattttttgttttaa

DBGET integrated database retrieval system