KEGG   Wigglesworthia glossinidia morsitans (Glossina morsitans): WIGMOR_0574Help
Entry
WIGMOR_0574       CDS       T01747                                 

Gene name
murE
Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate:meso-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
wgl  Wigglesworthia glossinidia morsitans (Glossina morsitans)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:wgl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    WIGMOR_0574 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    WIGMOR_0574 (murE)
Enzymes [BR:wgl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     WIGMOR_0574 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
593887..595383
Genome map
AA seq 498 aa AA seqDB search
MVNYIDLKKLIFPWVSSKEIPSIKLDNLTLNSKKVTQNTLFIAISGNKQHGKKFIFEAIQ
NGSTAILVETNNMRKHGKMYYVNTIPIIYFYQLNRHLSELSGKFYYHPSKYMQLIGITGT
NGKTTVAYFITQWLNFLGKKSGIMGTLGYGQINKLHKSENTTYSAIKCQKVLKNFLKKNI
RIISMEVSSHGLSQDRVNYLYFTIAVFTNLSHEHLDYHKNMIQYENSKWKLFSELSVSKY
IINIDDNVGKNWAKKFPQAIIVSTKYNLSKKFKNLKIYVKKIFFHCYGTKITIVSSWGTE
IVNVKLFGKFNINNLLIACAVLLIQGHSFTRILNYIEKIHMPQGRMEIFYLKKLPKIIID
YAHTPDALEKLLITIKLHFKTDMYVIFGCGGNRDREKRAIMGKICEKYAKNIIITNDNPR
YENEEQIFSDIKIGIKNFNNVKFIPSRKKAIKFAVQNSNKKDIVMILGKGHEEYQQFYSQ
KYFYSDKIVVKEILKKII
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggttaattatatagatttaaaaaaattaatttttccttgggtttcttcaaaagaaatt
cccagtattaaattagataatttgacattaaatagcaaaaaagtaactcaaaatacttta
tttattgctatatcgggaaataaacaacacggaaaaaaatttatttttgaagcaattcaa
aatggatctacagccatacttgtagaaacaaataatatgcgtaaacatggaaaaatgtat
tatgttaatacaataccgataatttatttttatcagttaaatcgtcatctttcagaatta
tcaggtaaattttattatcatccgtcaaaatatatgcaattaattggtattacagggaca
aatggaaaaactacagtggcatattttattacacaatggctgaattttttaggaaaaaaa
agcggtattatgggtactttaggatatgggcagattaacaaacttcataaatccgaaaac
actacttattctgctattaaatgtcaaaaagttttaaaaaattttttgaaaaaaaatatt
cgcattatttctatggaagtatcttcacatggattatctcaagatagagtaaattacttg
tattttacaatagctgtttttactaacttaagtcatgaacatttagattatcataaaaat
atgattcaatatgagaattcaaaatggaaattattttccgaattatctgtatcaaaatat
attattaatatcgacgataatgttggaaaaaattgggcaaaaaaatttcctcaagctatt
atagtttctacaaaatataatttatctaaaaaatttaaaaatcttaaaatatatgtaaaa
aaaattttttttcactgttatggaacaaaaataacaattgtttctagttggggcacagaa
atagtaaatgtaaaattatttggaaaatttaatattaataatttattaattgcctgcgct
gtattattaatacaaggacattcttttacaagaattttaaattatattgaaaaaattcat
atgcctcaaggacgtatggaaatattttatttgaaaaaattacctaaaattattatagat
tatgctcatactccagatgctttagaaaaattgttaattacaataaaattgcattttaaa
acagatatgtatgttatatttggatgtggaggtaatcgagatcgtgaaaagcgtgcaata
atgggtaaaatatgcgagaaatatgctaaaaatattatcattacaaatgataatcctcga
tatgaaaatgaagaacaaatattttctgatattaaaattggaataaaaaattttaataat
gttaaatttattccatctagaaaaaaagctataaaatttgctgttcaaaacagtaataaa
aaagatattgttatgattttaggaaaaggtcatgaagaatatcaacaattttattctcaa
aaatatttttattcagacaaaattgttgtaaaagaaatattaaaaaaaatcatatga

DBGET integrated database retrieval system