KEGG   Weissella koreensis: WKK_00760Help
Entry
WKK_00760         CDS       T01577                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
wko  Weissella koreensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:wko00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(160784..162286)
Genome map
AA seq 500 aa AA seqDB search
MTKEYVMAIDQGTTSTRVILYDKNGNTVGMVKKELPQIFQEPGWVEHDANQIWIDTEWLM
QQVLTKYDIPAQEIDSIGITNQRETTVLWDRETGEPVAPAIVWQSKQSNIMADKLKENHL
EEKIYDKTGLWIDSYFSATKIMWLLDQNSELKQLMDENRLRFGTIDSWLLWKLTRGKVHA
TDYTNASRTMLFNIHTLQWDPELLELYGINPNLLPKVKNSSDDFGETILKGVPIKIGALA
GDQQAALFGHQAFKPGSIKSTYGTGAFIVMNTGDQPKVSKHGLLTTIAYGLNGKITYALE
GSIFVAGSAVQWLEEGMDIIDNSAMSAEYAYQSSQSVPYQDIYLVPAFTGLGAPYWDQKI
RGAAFGLTRATRNQDLVRATIESLAYQTKDVLDVMTVDTGLTRTHLSIDGGAAANEYLHE
FMADLLQIKITRPRKLEMTARGIAYLAGLQSGFWSSIDQLPDNPEMLTVDYNEEHKQTMQ
KHYENWQKSVKAAQKFAYHR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagaatatgtaatggcaattgatcaaggaaccactagtactcgcgtcatttta
tatgataaaaatggtaatacagtagggatggttaaaaaagagctacctcaaatttttcag
gagccaggctgggttgaacacgatgcaaatcaaatttggattgacactgagtggttgatg
cagcaagttttaacaaaatatgatattcctgctcaggagattgattcaattggaattact
aatcaacgcgaaacaacagttttatgggaccgagaaaccggtgaaccagtagcgccagct
attgtttggcaatctaagcagtcaaatataatggctgataaactcaaagaaaatcattta
gaagaaaaaatatatgataaaacgggtctatggattgattcatatttttcagcaactaaa
ataatgtggttattagaccaaaattcagaattaaaacaattgatggatgagaatcgactt
cgttttgggacaatagattcgtggctgttgtggaagctcactagaggaaaggtccatgct
acggattataccaatgcatcacgaactatgctttttaatattcatactttgcaatgggat
ccagagttattggagctttatggaattaacccaaacttattgccgaaagttaaaaattca
tcagatgattttggtgaaacgattctgaaaggtgttccaattaagattggagcattagct
ggtgatcagcaagctgccttgtttggacatcaagcatttaagcctggttctattaaaagt
acatatgggactggcgcgtttattgtcatgaacactggagatcaaccaaaagtttcaaag
catggtttgctaacaacgattgcttatggtttaaacggaaaaatcacatatgcacttgaa
ggttcaattttcgtcgctggatcagcagttcagtggttagaagaaggaatggatatcatt
gataattcagcaatgtcagcagaatatgcttatcagtcaagccagtcagttccttatcaa
gatatttacctggtaccagcttttacgggccttggtgcaccttattgggatcaaaaaatt
cgtggagctgcttttggattaactagagcaactcgaaatcaagatttggtacgagctaca
attgaatctttggcatatcaaactaaagatgttttagatgtaatgaccgttgatacagga
ctcacacgaactcatctgtctattgatggtggtgctgcagcgaacgaatatttgcatgaa
tttatggctgatttacttcaaataaaaatcacgagaccacgaaaacttgaaatgactgct
cgtggaattgcgtatttagctggattacaaagtggattttggtcatctattgatcaacta
cccgataatcctgagatgctaacggttgactataatgaagagcataaacagacaatgcaa
aaacattatgaaaattggcaaaaatccgttaaagctgctcaaaagtttgcatatcatcga
taa

DBGET integrated database retrieval system