KEGG   Weissella koreensis: WKK_01560Help
Entry
WKK_01560         CDS       T01577                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
wko  Weissella koreensis
Pathway
wko00230  Purine metabolism
wko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wko00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    WKK_01560 (gmk)
Enzymes [BR:wko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     WKK_01560 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 MMR_HSR1 AAA_22 RsgA_GTPase AAA_16 AAA Rad17 ABC_tran
Motif
Other DBs
NCBI-ProteinID: AEJ23188
UniProt: F8I0G0
Position
complement(307955..308572)
Genome map
AA seq 205 aa AA seqDB search
MKRGVLIVLSGPSGVGKGTVRKALFEEPDIDFTYSISMTTRQPRNGEVDGEDYFFVNRNE
FEENITAGNMLEYAEYVGNYYGTPKSFIDNTLASGHDVFLEIDVQGALQVKEKMPEGAYI
FLTPPDLQALKERLVGRGTDDPEIIDRRVAAASSEIRMMSKYDYAVVNDEVQLAVQRIKD
IVKVERLRVNRILPEYIAMIEELEK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtggggttttaattgtattatcaggaccatcaggagtaggtaagggaacagtt
cgtaaagccttatttgaagaaccagatattgattttacatattctatttcaatgactact
cgtcaaccacgcaatggtgaagtagacggggaagattacttctttgtgaaccgtaatgaa
tttgaagaaaatattactgctgggaatatgctagagtatgccgagtatgttggcaattat
tatggaacgccaaaaagttttattgacaatactcttgcgtcgggacatgatgttttcttg
gaaattgatgttcaaggggctttgcaagttaaagaaaaaatgcctgaaggggcatacatc
tttttgaccccaccagatttacaggccttaaaagaacgtttagttggtcgtggaactgat
gatccagaaattattgaccgacgagtggcggcggcatcatctgaaattcggatgatgtca
aaatatgactacgctgtggtcaatgatgaagttcagttagcagtacaacgaattaaagat
attgttaaggtcgaacgtttaagagttaatcgtattttaccagaatatatagccatgatt
gaggagttagaaaaatga

DBGET integrated database retrieval system