KEGG   Weissella koreensis: WKK_01885Help
Entry
WKK_01885         CDS       T01577                                 

Definition
(GenBank) N-acetyl-beta-hexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
wko  Weissella koreensis
Pathway
wko00511  Other glycan degradation
wko00520  Amino sugar and nucleotide sugar metabolism
wko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wko00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    WKK_01885
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    WKK_01885
Enzymes [BR:wko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     WKK_01885
Chaperones and folding catalysts [BR:wko03110]
 Intramolecular chaperones
  Others
   WKK_01885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 HtrL_YibB Imm-NTF2
Motif
Other DBs
NCBI-ProteinID: AEJ23253
UniProt: F8I121
Position
complement(382008..382808)
Genome map
AA seq 266 aa AA seqDB search
MSKKELKQLVQYAEEHNIQLVPDVDVPSHMGAILKQLKVSHPEIYHQVKLDEETIDYTNP
KSIELVKKIYGELNPIFSKQTNLNFVIGADEVPGNIVLHKDLVKFINQINRYQNQAGFTN
VIWNDQILKKELKNLDYNLIINYWSHSGNHDAPNQAKLLMNRNKNYISVNDAFRLDRKII
NSNSYVLYYQMKNIGNKQQDRYVLDILNNKWEPNIFNEIDQKGNNQNWTVEPEVKLQGYE
FSLWGENSKLISFKSIINFINKLKLV
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaaaaaaagaactaaagcagctagtacaatatgctgaagaacataacattcaatta
gtacctgatgttgatgttccctcacatatgggagccattttaaaacaattaaaggtaagt
catcctgaaatttatcatcaggtaaagttagatgaagaaacgattgattatactaatcct
aaatcgattgaattagttaaaaaaatatatggtgaacttaatccaatattttcaaaacaa
accaatttgaattttgtgattggggcagatgaggtgcctggtaatattgtattacacaag
gatttagttaaatttataaatcaaatcaatcggtatcaaaatcaagctggttttactaac
gtaatttggaatgatcaaattttaaagaaagaacttaaaaatttagattacaatttaatt
attaattattggtcacattcaggtaatcatgatgcaccaaatcaagccaaattattgatg
aatcgaaataaaaattatatttcggtgaacgatgcatttagacttgatcggaaaataatt
aattctaatagttatgtattatattatcaaatgaaaaacataggcaataaacagcaggat
cgatatgtattagacattttaaataacaaatgggagccaaatatatttaatgaaattgat
caaaaagggaataatcaaaattggacagttgagccagaagttaaattacaaggttatgaa
ttttcgttatggggagaaaattctaagctaatttcatttaaatctattattaattttatt
aataagcttaagttggtttga

DBGET integrated database retrieval system